PTPRCAP (protein tyrosine phosphatase receptor type C associated protein)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5790
Gene name Protein tyrosine phosphatase receptor type C associated protein
Gene symbol PTPRCAP
Synonyms (NCBI Gene)
CD45-APLPAP
Chromosome 11
Chromosome location 11q13.2
Summary The protein encoded by this gene was identified as a transmembrane phosphoprotein specifically associated with tyrosine phosphatase PTPRC/CD45, a key regulator of T- and B-lymphocyte activation. The interaction with PTPRC may be required for the stable ex
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1275994 hsa-miR-4278 CLIP-seq
MIRT1275995 hsa-miR-4645-3p CLIP-seq
MIRT1275996 hsa-miR-4716-3p CLIP-seq
MIRT1275997 hsa-miR-542-3p CLIP-seq
MIRT1275998 hsa-miR-582-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 11390434
GO:0006952 Process Defense response TAS 7961877
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601577 9667 ENSG00000213402
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14761
Protein name Protein tyrosine phosphatase receptor type C-associated protein (PTPRC-associated protein) (CD45-associated protein) (CD45-AP) (Lymphocyte phosphatase-associated phosphoprotein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15713 PTPRCAP 58 → 206 Protein tyrosine phosphatase receptor type C-associated Family
Sequence 
MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD
SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD
GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL
HAFAGSAAWDDSARAAGGQGLHVTAL
Sequence length 206
Interactions View interactions

No strongly related genes found yet for PTPRCAP.

No additional diseases found yet through genes similar to PTPRCAP.