PTPN20 (protein tyrosine phosphatase non-receptor type 20)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 26095
Gene name Protein tyrosine phosphatase non-receptor type 20
Gene symbol PTPN20
Synonyms (NCBI Gene)
CT126PTPN20APTPN20BbA142I17.1bA42B19.1
Chromosome 10
Chromosome location 10q11.22
Summary The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001946 Process Lymphangiogenesis IBA
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004725 Function Protein tyrosine phosphatase activity IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610630 23423 ENSG00000204179
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4JDL3
Protein name Tyrosine-protein phosphatase non-receptor type 20 (hPTPN20) (EC 3.1.3.48)
Protein function Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00102 Y_phosphatase 183 → 411 Protein-tyrosine phosphatase Domain
Tissue specificity TISSUE SPECIFICITY: Present in many cell lines (at protein level). Widely expressed. {ECO:0000269|PubMed:15790311}.
Sequence 
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVS
EGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF
QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRT
GVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
Sequence length 420
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Interleukin-37 signaling

No strongly related genes found yet for PTPN20.

No additional diseases found yet through genes similar to PTPN20.