PSPHP1 (phosphoserine phosphatase pseudogene 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 8781 |
| Gene name | Phosphoserine phosphatase pseudogene 1 |
| Gene symbol | PSPHP1 |
| Synonyms (NCBI Gene) |
CO9PSPHL
|
| Chromosome | 7 |
| Chromosome location | 7p11.2 |
| Summary | This gene is significantly upregulated in Fanconi`s anemia fibroblasts but downregulated or absent in fibroblasts from normal donors. It is also highly expressed in FA B-cells of complementation group A. [provided by RefSeq, Jul 2008] |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
O15172 |
| Protein name | Putative phosphoserine phosphatase-like protein (L-3-phosphoserine-phosphatase homolog) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Highly expressed in FA (Fanconi's anemia) B-cells of complementation group A and Raji cells. Not expressed in B-cells of other FA complementation groups. {ECO:0000269|PubMed:9573387}. |
| Sequence |
MASASCSPGGALASPEPGRKILPRMISHSELRKLFYSADAVCFDVDSTVISEEGIGCFHW |
| Sequence length | 72 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with PSPHP1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to PSPHP1 (see Related Genes above), that are NOT already directly curated for PSPHP1 itself -- a lead worth checking, not a confirmed association.
0
|
|