PSME3IP1 (proteasome activator subunit 3 interacting protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80011
Gene name Proteasome activator subunit 3 interacting protein 1
Gene symbol PSME3IP1
Synonyms (NCBI Gene)
C16orf94CDA018CDA10FAM192ANIP30PIP30
Chromosome 16
Chromosome location 16q13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 29934401, 33961781, 35271311
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 29934401
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617766 29856 ENSG00000172775
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GZU8
Protein name PSME3-interacting protein (NEFA-interacting nuclear protein NIP30) (PA28G-interacting protein)
Protein function Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the
PDB 7W59 , 7W5A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10187 FAM192A_Fyv6_N 15 → 116 FAM192A/Fyv6, N-terminal domain Domain
Sequence 
MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQE
QKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLK
KVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDK
NQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKI
VSSIFRTNTFLEAP
Sequence length 254
Interactions View interactions

No strongly related genes found yet for PSME3IP1.

No additional diseases found yet through genes similar to PSME3IP1.