Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5709
Gene name	Proteasome 26S subunit, non-ATPase 3
Gene symbol	PSMD3
Synonyms (NCBI Gene)	P58RPN3S3TSTA2
Chromosome	17
Chromosome location	17q21.1
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049247	hsa-miR-92a-3p	CLASH	23622248
MIRT045113	hsa-miR-186-5p	CLASH	23622248
MIRT044009	hsa-miR-378a-5p	CLASH	23622248
MIRT040625	hsa-miR-92b-3p	CLASH	23622248
MIRT039148	hsa-miR-769-5p	CLASH	23622248
MIRT036722	hsa-miR-760	CLASH	23622248
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2079495	hsa-miR-147	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2079497	hsa-miR-3191	CLIP-seq
MIRT2079498	hsa-miR-3911	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT2079499	hsa-miR-4648	CLIP-seq
MIRT2079500	hsa-miR-4652-5p	CLIP-seq
MIRT2079501	hsa-miR-4654	CLIP-seq
MIRT2079502	hsa-miR-4668-5p	CLIP-seq
MIRT2079503	hsa-miR-4769-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT2079504	hsa-miR-644	CLIP-seq
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT2305788	hsa-miR-1285	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT2305789	hsa-miR-149	CLIP-seq
MIRT2305790	hsa-miR-188-3p	CLIP-seq
MIRT2305791	hsa-miR-1909	CLIP-seq
MIRT2305792	hsa-miR-1976	CLIP-seq
MIRT2305793	hsa-miR-2114	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT2305794	hsa-miR-300	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2305795	hsa-miR-3168	CLIP-seq
MIRT2305796	hsa-miR-3613-3p	CLIP-seq
MIRT2305797	hsa-miR-361-3p	CLIP-seq
MIRT2305798	hsa-miR-3617	CLIP-seq
MIRT2305799	hsa-miR-362-5p	CLIP-seq
MIRT2305800	hsa-miR-3652	CLIP-seq
MIRT2305801	hsa-miR-3667-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT2305802	hsa-miR-381	CLIP-seq
MIRT2305803	hsa-miR-4277	CLIP-seq
MIRT2305804	hsa-miR-4286	CLIP-seq
MIRT2305805	hsa-miR-4423-5p	CLIP-seq
MIRT2305806	hsa-miR-4430	CLIP-seq
MIRT2305807	hsa-miR-4435	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT2305808	hsa-miR-4509	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT2305809	hsa-miR-4532	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT2305810	hsa-miR-4667-3p	CLIP-seq
MIRT2305811	hsa-miR-4672	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT2305812	hsa-miR-4722-3p	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT2305813	hsa-miR-4725-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT2305814	hsa-miR-500b	CLIP-seq
MIRT2305815	hsa-miR-501-5p	CLIP-seq
MIRT2305816	hsa-miR-504	CLIP-seq
MIRT2305817	hsa-miR-532-3p	CLIP-seq
MIRT2305818	hsa-miR-548c-3p	CLIP-seq
MIRT2305819	hsa-miR-554	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT2305820	hsa-miR-641	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2457362	hsa-miR-2355-5p	CLIP-seq
MIRT2457363	hsa-miR-3162-3p	CLIP-seq
MIRT2457364	hsa-miR-3679-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	15147878, 16990800, 25036637, 25416956, 25814554, 25910212, 26030138, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
617676	9560	ENSG00000108344

O43242

Protein name

26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	358 → 462	PCI domain	Domain
PF08375	Rpn3_C	465 → 532	Proteasome regulatory subunit C-terminal	Family

Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Sequence length

534

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID HEMIAGENESIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	GWASDB_DG	20860503		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	22037903	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	27163155		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534, 31013812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34839279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22037903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25969153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24068912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23303871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36498916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	25515861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18559534, 31013812		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31173190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmia Syndromic 6	Microphthalmia	Pubtator	28390009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	27388770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31013812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	25515861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37349676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	22936693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29286091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	28390009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMD3 (proteasome 26S subunit, non-ATPase 3)