PSMD3 (proteasome 26S subunit, non-ATPase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5709
• Gene name: Proteasome 26S subunit, non-ATPase 3
• Gene symbol: PSMD3
• Synonyms (NCBI Gene): P58, RPN3, S3, TSTA2
• Chromosome: 17
• Chromosome location: 17q21.1
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049247	hsa-miR-92a-3p	CLASH	23622248
MIRT045113	hsa-miR-186-5p	CLASH	23622248
MIRT044009	hsa-miR-378a-5p	CLASH	23622248
MIRT040625	hsa-miR-92b-3p	CLASH	23622248
MIRT039148	hsa-miR-769-5p	CLASH	23622248
MIRT036722	hsa-miR-760	CLASH	23622248
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2079495	hsa-miR-147	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2079497	hsa-miR-3191	CLIP-seq
MIRT2079498	hsa-miR-3911	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT2079499	hsa-miR-4648	CLIP-seq
MIRT2079500	hsa-miR-4652-5p	CLIP-seq
MIRT2079501	hsa-miR-4654	CLIP-seq
MIRT2079502	hsa-miR-4668-5p	CLIP-seq
MIRT2079503	hsa-miR-4769-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT2079504	hsa-miR-644	CLIP-seq
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT2305788	hsa-miR-1285	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT2305789	hsa-miR-149	CLIP-seq
MIRT2305790	hsa-miR-188-3p	CLIP-seq
MIRT2305791	hsa-miR-1909	CLIP-seq
MIRT2305792	hsa-miR-1976	CLIP-seq
MIRT2305793	hsa-miR-2114	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT2305794	hsa-miR-300	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2305795	hsa-miR-3168	CLIP-seq
MIRT2305796	hsa-miR-3613-3p	CLIP-seq
MIRT2305797	hsa-miR-361-3p	CLIP-seq
MIRT2305798	hsa-miR-3617	CLIP-seq
MIRT2305799	hsa-miR-362-5p	CLIP-seq
MIRT2305800	hsa-miR-3652	CLIP-seq
MIRT2305801	hsa-miR-3667-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT2305802	hsa-miR-381	CLIP-seq
MIRT2305803	hsa-miR-4277	CLIP-seq
MIRT2305804	hsa-miR-4286	CLIP-seq
MIRT2305805	hsa-miR-4423-5p	CLIP-seq
MIRT2305806	hsa-miR-4430	CLIP-seq
MIRT2305807	hsa-miR-4435	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT2305808	hsa-miR-4509	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT2305809	hsa-miR-4532	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT2305810	hsa-miR-4667-3p	CLIP-seq
MIRT2305811	hsa-miR-4672	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT2305812	hsa-miR-4722-3p	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT2305813	hsa-miR-4725-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT2305814	hsa-miR-500b	CLIP-seq
MIRT2305815	hsa-miR-501-5p	CLIP-seq
MIRT2305816	hsa-miR-504	CLIP-seq
MIRT2305817	hsa-miR-532-3p	CLIP-seq
MIRT2305818	hsa-miR-548c-3p	CLIP-seq
MIRT2305819	hsa-miR-554	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT2305820	hsa-miR-641	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2457362	hsa-miR-2355-5p	CLIP-seq
MIRT2457363	hsa-miR-3162-3p	CLIP-seq
MIRT2457364	hsa-miR-3679-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	15147878, 16990800, 25036637, 25416956, 25814554, 25910212, 26030138, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 617676
• HGNC: 9560
• e!Ensembl: ENSG00000108344

Protein

• UniProt ID: O43242
• Protein name: 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01399	PCI	358 → 462	PCI domain	Domain
  PF08375	Rpn3_C	465 → 532	Proteasome regulatory subunit C-terminal	Family

• Sequence:

  MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
  EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
  FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
  YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
  RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
  EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
  FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
  DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
  SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

• Sequence length: 534

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	Neutrophil degranulation
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	GWAS catalog	29083406, 31619474, 31669095, 35126453	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	35126453	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID HEMIAGENESIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (22)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	GWASDB_DG	20860503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	22037903	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	27163155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534, 31013812		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34839279	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22037903	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25969153		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24068912	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23303871	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMC2 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC3 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC4 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC5 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC6 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMC2	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC3	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC4	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC5	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC6	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesPSMC3, PSMC6 Neurodevelopmental disorder Linked via 2 of 5 related genesPSMC3, PSMC5 Hearing loss Linked via 1 of 5 related genesPSMC2 Diabetes mellitus type 2 Linked via 1 of 5 related genesPSMC2 Anomalous pulmonary venous Linked via 1 of 5 related genesPSMC3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["PSMC3","PSMC6"]
Neurodevelopmental disorder	2	["PSMC3","PSMC5"]
Hearing loss	1	["PSMC2"]
Diabetes mellitus type 2	1	["PSMC2"]
Anomalous pulmonary venous	1	["PSMC3"]