Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5719
Gene name	Proteasome 26S subunit, non-ATPase 13
Gene symbol	PSMD13
Synonyms (NCBI Gene)	HSPC027Rpn9S11p40.5
Chromosome	11
Chromosome location	11p15.5
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047716	hsa-miR-10a-5p	CLASH	23622248
MIRT047503	hsa-miR-10b-5p	CLASH	23622248
MIRT047134	hsa-miR-183-5p	CLASH	23622248
MIRT045260	hsa-miR-186-5p	CLASH	23622248
MIRT040064	hsa-miR-615-3p	CLASH	23622248
MIRT038884	hsa-miR-93-3p	CLASH	23622248
MIRT1270458	hsa-miR-604	CLIP-seq
MIRT1270459	hsa-miR-647	CLIP-seq
MIRT2603050	hsa-miR-1184	CLIP-seq
MIRT2603051	hsa-miR-1205	CLIP-seq
MIRT2603052	hsa-miR-125a-5p	CLIP-seq
MIRT2603053	hsa-miR-125b	CLIP-seq
MIRT2603054	hsa-miR-1286	CLIP-seq
MIRT2603055	hsa-miR-1303	CLIP-seq
MIRT2603056	hsa-miR-132	CLIP-seq
MIRT2603057	hsa-miR-1324	CLIP-seq
MIRT2603058	hsa-miR-149	CLIP-seq
MIRT2603059	hsa-miR-185	CLIP-seq
MIRT2603060	hsa-miR-1910	CLIP-seq
MIRT2603061	hsa-miR-212	CLIP-seq
MIRT2603062	hsa-miR-2278	CLIP-seq
MIRT2603063	hsa-miR-3158-5p	CLIP-seq
MIRT2603064	hsa-miR-339-5p	CLIP-seq
MIRT2603065	hsa-miR-3667-5p	CLIP-seq
MIRT2603066	hsa-miR-4270	CLIP-seq
MIRT2603067	hsa-miR-4303	CLIP-seq
MIRT2603068	hsa-miR-4306	CLIP-seq
MIRT2603069	hsa-miR-4319	CLIP-seq
MIRT2603070	hsa-miR-4324	CLIP-seq
MIRT2603071	hsa-miR-4329	CLIP-seq
MIRT2603072	hsa-miR-4441	CLIP-seq
MIRT2603073	hsa-miR-4468	CLIP-seq
MIRT2603074	hsa-miR-451b	CLIP-seq
MIRT2603075	hsa-miR-4644	CLIP-seq
MIRT2603076	hsa-miR-4661-3p	CLIP-seq
MIRT2603077	hsa-miR-4722-5p	CLIP-seq
MIRT2603078	hsa-miR-4725-5p	CLIP-seq
MIRT2603079	hsa-miR-4733-5p	CLIP-seq
MIRT2603080	hsa-miR-4768-3p	CLIP-seq
MIRT2603081	hsa-miR-4768-5p	CLIP-seq
MIRT2603082	hsa-miR-4773	CLIP-seq
MIRT2603083	hsa-miR-4786-5p	CLIP-seq
MIRT2603084	hsa-miR-504	CLIP-seq
MIRT2603085	hsa-miR-564	CLIP-seq
MIRT2603086	hsa-miR-622	CLIP-seq
MIRT2603087	hsa-miR-663b	CLIP-seq
MIRT2603088	hsa-miR-769-5p	CLIP-seq
MIRT2603050	hsa-miR-1184	CLIP-seq
MIRT2603051	hsa-miR-1205	CLIP-seq
MIRT2603052	hsa-miR-125a-5p	CLIP-seq
MIRT2603053	hsa-miR-125b	CLIP-seq
MIRT2603054	hsa-miR-1286	CLIP-seq
MIRT2603055	hsa-miR-1303	CLIP-seq
MIRT2603056	hsa-miR-132	CLIP-seq
MIRT2603057	hsa-miR-1324	CLIP-seq
MIRT2603058	hsa-miR-149	CLIP-seq
MIRT2603059	hsa-miR-185	CLIP-seq
MIRT2603060	hsa-miR-1910	CLIP-seq
MIRT2603061	hsa-miR-212	CLIP-seq
MIRT2603062	hsa-miR-2278	CLIP-seq
MIRT2603063	hsa-miR-3158-5p	CLIP-seq
MIRT2603064	hsa-miR-339-5p	CLIP-seq
MIRT2603065	hsa-miR-3667-5p	CLIP-seq
MIRT2603066	hsa-miR-4270	CLIP-seq
MIRT2603068	hsa-miR-4306	CLIP-seq
MIRT2603069	hsa-miR-4319	CLIP-seq
MIRT2603070	hsa-miR-4324	CLIP-seq
MIRT2603071	hsa-miR-4329	CLIP-seq
MIRT2603072	hsa-miR-4441	CLIP-seq
MIRT2603074	hsa-miR-451b	CLIP-seq
MIRT2603075	hsa-miR-4644	CLIP-seq
MIRT2603076	hsa-miR-4661-3p	CLIP-seq
MIRT2603077	hsa-miR-4722-5p	CLIP-seq
MIRT2603078	hsa-miR-4725-5p	CLIP-seq
MIRT2603079	hsa-miR-4733-5p	CLIP-seq
MIRT2603080	hsa-miR-4768-3p	CLIP-seq
MIRT2603081	hsa-miR-4768-5p	CLIP-seq
MIRT2603082	hsa-miR-4773	CLIP-seq
MIRT2603083	hsa-miR-4786-5p	CLIP-seq
MIRT2603084	hsa-miR-504	CLIP-seq
MIRT2603085	hsa-miR-564	CLIP-seq
MIRT2603086	hsa-miR-622	CLIP-seq
MIRT2603087	hsa-miR-663b	CLIP-seq
MIRT2603088	hsa-miR-769-5p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005198	Function	Structural molecule activity	IBA
GO:0005515	Function	Protein binding	IPI	16990800, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0005838	Component	Proteasome regulatory particle	TAS	9714768
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0007127	Process	Meiosis I	IEA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
603481	9558	ENSG00000185627

Q9UNM6

Protein name

26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	231 → 335	PCI domain	Domain

Sequence

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAF
NSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDV
KSMEMLVEHQAHDILT

Sequence length

376

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSMD13-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27534557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26624926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39239747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26624926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36731897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	25752820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber congenital amaurosis	Pubtator	25752820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37653079	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26624926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26624926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	40443672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	40443672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMD13 (proteasome 26S subunit, non-ATPase 13)