Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5688
Gene name	Proteasome 20S subunit alpha 7
Gene symbol	PSMA7
Synonyms (NCBI Gene)	C6HEL-S-276HSPCRC6-1XAPC7
Chromosome	20
Chromosome location	20q13.33
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

151 Show/Hide all (151)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049617	hsa-miR-92a-3p	CLASH	23622248
MIRT041274	hsa-miR-193b-3p	CLASH	23622248
MIRT040706	hsa-miR-92b-3p	CLASH	23622248
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	27292025
MIRT456019	hsa-miR-1-3p	PAR-CLIP	27292025
MIRT456018	hsa-miR-206	PAR-CLIP	27292025
MIRT456026	hsa-miR-224-3p	PAR-CLIP	27292025
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	27292025
MIRT456014	hsa-miR-3978	PAR-CLIP	27292025
MIRT456020	hsa-miR-4302	PAR-CLIP	27292025
MIRT456023	hsa-miR-4643	PAR-CLIP	27292025
MIRT456015	hsa-miR-466	PAR-CLIP	27292025
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	27292025
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	27292025
MIRT456025	hsa-miR-522-3p	PAR-CLIP	27292025
MIRT456017	hsa-miR-613	PAR-CLIP	27292025
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16251969, 16990800, 17948026, 19416853, 21900206, 21988832, 25599644, 25959826, 28514442, 29568061, 29636472, 31473102, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0042802	Function	Identical protein binding	IPI	15225636, 17948026
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

MIM	HGNC	e!Ensembl
606607	9536	ENSG00000101182

O14818

Protein name

Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) (Proteasome subunit alpha-4) (alpha-4)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	26 → 211	Proteasome subunit	Domain
PF10584	Proteasome_A_N	3 → 25	Proteasome subunit A N-terminal signature	Family

Sequence

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS

Sequence length

248

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSMA7-related disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (67)
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31784425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22584585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30390597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28610635, 29789357, 30972754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	3487293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21704099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34604955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37369480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29247526		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSMA1	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA2	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA3	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA4	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA5	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]

PSMA7 (proteasome 20S subunit alpha 7)

Bookmark This Gene