Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5688
Gene name	Proteasome 20S subunit alpha 7
Gene symbol	PSMA7
Synonyms (NCBI Gene)	C6HEL-S-276HSPCRC6-1XAPC7
Chromosome	20
Chromosome location	20q13.33
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

151

Show/Hide all (151)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049617	hsa-miR-92a-3p	CLASH	23622248
MIRT041274	hsa-miR-193b-3p	CLASH	23622248
MIRT040706	hsa-miR-92b-3p	CLASH	23622248
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	27292025
MIRT456019	hsa-miR-1-3p	PAR-CLIP	27292025
MIRT456018	hsa-miR-206	PAR-CLIP	27292025
MIRT456026	hsa-miR-224-3p	PAR-CLIP	27292025
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	27292025
MIRT456014	hsa-miR-3978	PAR-CLIP	27292025
MIRT456020	hsa-miR-4302	PAR-CLIP	27292025
MIRT456023	hsa-miR-4643	PAR-CLIP	27292025
MIRT456015	hsa-miR-466	PAR-CLIP	27292025
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	27292025
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	27292025
MIRT456025	hsa-miR-522-3p	PAR-CLIP	27292025
MIRT456017	hsa-miR-613	PAR-CLIP	27292025
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16251969, 16990800, 17948026, 19416853, 21900206, 21988832, 25599644, 25959826, 28514442, 29568061, 29636472, 31473102, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0042802	Function	Identical protein binding	IPI	15225636, 17948026
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

MIM	HGNC	e!Ensembl
606607	9536	ENSG00000101182

O14818

Protein name

Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) (Proteasome subunit alpha-4) (alpha-4)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	3 → 25	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	26 → 211	Proteasome subunit	Domain

Sequence

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS

Sequence length

248

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSMA7-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31784425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22584585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30390597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28610635, 29789357, 30972754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	3487293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21704099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34604955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37369480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29247526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29247526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	25479752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31271815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18202793, 19787246, 31589818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18202793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23839082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement component deficiency	Pubtator	10632667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement Component Deficiency	GENOMICS_ENGLAND_DG	12653841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement Component Deficiency	CLINVAR_DG	12653841, 22288589, 8690922, 9472666, 9856498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement Component Deficiency	BEFREE	15568620, 3430506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement Component Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement Component Deficiency	BEFREE	28192236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	GENOMICS_ENGLAND_DG	12653841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25249547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28523434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	30390597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	36334414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31302210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor VIII Deficiency	Factor VIII Deficiency	BEFREE	6811172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	31543367		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	31543367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30716505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29327082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	28780274, 6811172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	3430506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunodeficiency due to a late component of complement deficiency	Immunodeficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28523434		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25479752, 31545325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27389055, 31784425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	BEFREE	31150018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27173880, 28685716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17586700, 21707890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	25344067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	3430506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26624926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31612044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27173880, 28835380, 31612044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29247526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26624926		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30575819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25479752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21704099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25087473, 31271815, 31324713, 31612044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11344568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10554036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19893039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis Acquired	Pulmonary alveolar proteinosis	Pubtator	21707890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31612044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27966459	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28523434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38211649	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36334414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	31150018		★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMA7 (proteasome 20S subunit alpha 7)