PSIP1 (PC4 and SRSF1 interacting protein 1)

Gene

• Entrez ID: 11168
• Gene name: PC4 and SRSF1 interacting protein 1
• Gene symbol: PSIP1
• Synonyms (NCBI Gene): DFS70, LEDGF, PAIP, PSIP2, p52, p75
• Chromosome: 9
• Chromosome location: 9p22.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016293	hsa-miR-193b-3p	Microarray	20304954
MIRT019773	hsa-miR-375	Microarray	20215506
MIRT020538	hsa-miR-155-5p	Proteomics	18668040
MIRT023558	hsa-miR-1-3p	Proteomics	18668040
MIRT023558	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT016293	hsa-miR-193b-3p	CLASH	23622248
MIRT020538	hsa-miR-155-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23028330
MIRT020538	hsa-miR-155-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23028330
MIRT020538	hsa-miR-155-5p	ChIP-seq, Luciferase reporter assay, Western blot	26497687
MIRT1269756	hsa-miR-1231	CLIP-seq
MIRT1269757	hsa-miR-1299	CLIP-seq
MIRT1269758	hsa-miR-1323	CLIP-seq
MIRT1269759	hsa-miR-2276	CLIP-seq
MIRT1269760	hsa-miR-3143	CLIP-seq
MIRT1269761	hsa-miR-3148	CLIP-seq
MIRT1269762	hsa-miR-346	CLIP-seq
MIRT1269763	hsa-miR-365	CLIP-seq
MIRT1269764	hsa-miR-4288	CLIP-seq
MIRT1269765	hsa-miR-433	CLIP-seq
MIRT1269766	hsa-miR-4420	CLIP-seq
MIRT1269767	hsa-miR-4432	CLIP-seq
MIRT1269768	hsa-miR-4659a-3p	CLIP-seq
MIRT1269769	hsa-miR-4659b-3p	CLIP-seq
MIRT1269770	hsa-miR-4691-3p	CLIP-seq
MIRT1269771	hsa-miR-4772-3p	CLIP-seq
MIRT1269772	hsa-miR-499-5p	CLIP-seq
MIRT1269773	hsa-miR-518a-5p	CLIP-seq
MIRT1269774	hsa-miR-527	CLIP-seq
MIRT1269775	hsa-miR-543	CLIP-seq
MIRT1269776	hsa-miR-548o	CLIP-seq
MIRT1269777	hsa-miR-632	CLIP-seq
MIRT1269778	hsa-miR-654-3p	CLIP-seq
MIRT1269779	hsa-miR-875-3p	CLIP-seq
MIRT1269780	hsa-miR-200b	CLIP-seq
MIRT1269781	hsa-miR-200c	CLIP-seq
MIRT1269782	hsa-miR-2053	CLIP-seq
MIRT1269783	hsa-miR-217	CLIP-seq
MIRT1269784	hsa-miR-3667-5p	CLIP-seq
MIRT1269785	hsa-miR-374c	CLIP-seq
MIRT1269786	hsa-miR-384	CLIP-seq
MIRT1269787	hsa-miR-409-3p	CLIP-seq
MIRT1269788	hsa-miR-4274	CLIP-seq
MIRT1269789	hsa-miR-429	CLIP-seq
MIRT1269790	hsa-miR-4328	CLIP-seq
MIRT1269791	hsa-miR-4418	CLIP-seq
MIRT1269792	hsa-miR-4519	CLIP-seq
MIRT1269793	hsa-miR-4528	CLIP-seq
MIRT1269794	hsa-miR-509-3-5p	CLIP-seq
MIRT1269795	hsa-miR-509-5p	CLIP-seq
MIRT1269796	hsa-miR-548c-3p	CLIP-seq
MIRT1269797	hsa-miR-562	CLIP-seq
MIRT1269798	hsa-miR-569	CLIP-seq
MIRT1269799	hsa-miR-655	CLIP-seq
MIRT1269800	hsa-miR-885-5p	CLIP-seq
MIRT1552660	hsa-miR-607	CLIP-seq
MIRT2079285	hsa-miR-1298	CLIP-seq
MIRT2079286	hsa-miR-409-5p	CLIP-seq
MIRT2079287	hsa-miR-582-5p	CLIP-seq
MIRT2079288	hsa-miR-659	CLIP-seq
MIRT2457307	hsa-miR-1253	CLIP-seq
MIRT1269758	hsa-miR-1323	CLIP-seq
MIRT2457308	hsa-miR-139-3p	CLIP-seq
MIRT1269760	hsa-miR-3143	CLIP-seq
MIRT2457309	hsa-miR-362-5p	CLIP-seq
MIRT2457310	hsa-miR-3663-5p	CLIP-seq
MIRT2457311	hsa-miR-4272	CLIP-seq
MIRT2457312	hsa-miR-4698	CLIP-seq
MIRT2457313	hsa-miR-4725-5p	CLIP-seq
MIRT2457314	hsa-miR-4803	CLIP-seq
MIRT2457315	hsa-miR-500b	CLIP-seq
MIRT2457316	hsa-miR-501-5p	CLIP-seq
MIRT2457317	hsa-miR-504	CLIP-seq
MIRT1269776	hsa-miR-548o	CLIP-seq
MIRT2457318	hsa-miR-587	CLIP-seq
MIRT1552660	hsa-miR-607	CLIP-seq
MIRT2457319	hsa-miR-664	CLIP-seq
MIRT1269763	hsa-miR-365	CLIP-seq
MIRT1269766	hsa-miR-4420	CLIP-seq
MIRT1269767	hsa-miR-4432	CLIP-seq
MIRT1269772	hsa-miR-499-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Unknown	23386123
SP1	Unknown	22019592;23386123

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000395	Process	MRNA 5'-splice site recognition	IDA	9885563
GO:0000791	Component	Euchromatin	ISS
GO:0000792	Component	Heterochromatin	IDA	12796494
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	20974633
GO:0003713	Function	Transcription coactivator activity	IDA	9822615, 9885563
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	9885563, 17137594, 21156026, 22748127, 22773103, 22872640, 25082813, 25305204, 29997176
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12796494
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	9885563
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	11512661
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0009408	Process	Response to heat	IEA
GO:0009408	Process	Response to heat	ISS
GO:0034399	Component	Nuclear periphery	IDA	11512661
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9822615, 9885563
GO:0097100	Function	Supercoiled DNA binding	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IDA	9822615

Other IDs

• MIM: 603620
• HGNC: 9527
• e!Ensembl: ENSG00000164985

Protein

• UniProt ID: O75475
• Protein name: PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52)
• Protein function: Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell
• PDB: 1Z9E, 2B4J, 2M16, 2MSR, 2MTN, 2N3A, 3F9K, 3HPG, 3HPH, 3U88, 3ZEH, 4FU6, 5N88, 5OYM, 5YI9, 6EMO, 6EMP, 6EMQ, 6EMR, 6S01, 6TRJ, 6TVM, 6ZV0, 7OUF, 7OUG, 7OUH, 7PEL, 7Z1Z, 8CBN, 8CBQ, 8PC5, 8PC6, 8PEO, 8PEP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00855	PWWP	5 → 89	PWWP domain	Domain
  PF11467	LEDGF	349 → 450	Lens epithelium-derived growth factor (LEDGF)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventr
• Sequence:

  MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
  YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
  DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
  GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
  EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
  NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
  NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
  NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
  GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN

• Sequence length: 530

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	16173964		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19502791		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15948150		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26988706		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17550129		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22626591		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	15501396		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	15501396		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	LHGDN	15501396		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15056289, 21908873, 24475283, 28228570, 28698670		★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	19692701	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424, 31396837		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	14613990		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947419		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19490633	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	33133072	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20631726	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10856157		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12181742, 15501396, 22100330, 26771192, 29166758		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20484370, 22275515, 26771192	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37047137	Stimulate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	8329708		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30604907		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12438259, 14997042, 23138933, 28190248, 28633434, 31202267		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28633434	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24604027	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24670920	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15365563, 17363574		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	28633434	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30604907		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	7509279		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31839396		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26840454	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19934313, 26840454		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11358448		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11358448		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	28704293		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	15725483		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17550129		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17700442		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8329708		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25153701		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	8311838		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29806700		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25170898		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	22647853	Associate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30017652, 30928980, 30972541		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1320571		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24047966		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10856157		★☆☆☆☆ Found in Text Mining only
Detrusor and sphincter dyssynergia	Detrusor And Sphincter Dyssynergia	BEFREE	29806700		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18566344, 25200302, 31073629, 31541100		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18566344, 23065828, 25200302, 31073629, 31541100		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25636172, 28256087		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	15866349		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10856157		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28821608		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12032115, 18398367		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26840454		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30854807	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15365563		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7578985		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20353905	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	19142969		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	19142969		★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	28859856		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	27196595		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30940658		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39216044	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30940658		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17696644, 19724686, 25538243, 30092219		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19169037		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	27929668		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30848074		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30848074	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591, 26988706		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24285878		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	20506408		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10320052		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	21386984	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10320052		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	16054550		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	20506408		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30928980		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17363574		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25153701, 28380447, 28969308, 29604364, 30374941, 31543761		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28633434		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16108830		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11737860, 22019592	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18598937, 18598942, 25082813, 25305204, 29084774		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11737860, 20484370, 24634210, 30848074	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17451600	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11103774, 11737860, 22103895, 8445947		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15725483, 17451600		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30928980		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28420054, 29166758, 31396837		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24908319		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18081157, 21938001, 26278479, 28761093		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23576602		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15084380		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438259, 17018605, 22276150, 23138933, 28190248, 28633434, 31202267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30741921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31839396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19934313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15948150, 17143529, 19715609, 21796653, 22647853, 26771192, 28212536, 30305646, 30317243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15753984		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30604907		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15753984, 17143529, 17363574, 18974393, 19656388, 19724686, 22276150, 26112410, 26561285, 26771192, 28190248, 30928980		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19738070		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17550129		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12789270, 21418516, 8305739, 8908597		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24047966		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22103895		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	17018605, 18403643		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15982735		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17018605, 18403643		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26771192	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11389056, 11705863, 14576816, 14997042, 15084380, 15342406, 16555252, 17143529, 17973327, 18974393, 19142969, 19502791, 19724686, 19738070, 20224295, 22276150, 23576602, 27196595, 27888699, 28212536, 28560678, 28819854, 29666445		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	24475283, 28380447		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	16001231		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14654552, 16215672, 19142969, 20404560, 23314735, 24253178, 8656283, 9136990		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29604364		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17550129		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26449484	Associate	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	26178921		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34922489, 38225273	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19934313		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26840454	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	14613990		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21386984	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12741461		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24475283, 27981472, 30941646		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12032115		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	14997042		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30842294		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15948150, 17143529, 19715609, 21796653, 22647853, 26771192, 28212536, 30305646, 30317243		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37047137, 37501430	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18708362, 21796653, 22275515, 22647853, 24860838, 30305646, 37626856	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19715609	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26771192	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	22019592	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	20631726		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16555252, 17973327		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1320571, 31396837		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	22626591		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	30518018		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	16713178		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29166758		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30268558, 30895287		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16951226, 28534989, 28560678, 28819854, 30854807		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28447720		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15753984		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19490633	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	14576816		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28633434, 29801480, 31839752		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28633434	Stimulate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18081157		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31612319		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	11578690		★☆☆☆☆ Found in Text Mining only