PRSS45P (serine protease 45, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 377047
Gene name Serine protease 45, pseudogene
Gene symbol PRSS45P
Synonyms (NCBI Gene)
PRSS45TESPLTESSP5
Chromosome 3
Chromosome location 3p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005615 Component Extracellular space IBA
GO:0006508 Process Proteolysis IBA
GO:0006508 Process Proteolysis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 30717 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7RTY3
Protein name Putative serine protease 45 (EC 3.4.21.-) (Serine protease 45, pseudogene) (Testis serine protease 5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 1 → 229 Trypsin Domain
Sequence 
MTRHWPWEVSLRMENEHVCGGALIDPSWVVTAAHCIQGTKEYSVVLGTSKLQPMNFSRAL
WVPVRDIIMHPKYWGRAFIMGDVALVHLQTPVTFSEYVQPICLPEPNFNLKVGTQCWVTG
WSQVKQRFSANSMLTPELQEAEVFIMDNKRCDRHYKKSFFPPVVPLVLGDMICATNYGEN
LCYGDSGGPLACEVEGRWILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSG
PCASACLLFLCWLLQPQMGS
Sequence length 260
Interactions View interactions

No strongly related genes found yet for PRSS45P.

No additional diseases found yet through genes similar to PRSS45P.