Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	339906
Gene name	Serine protease 42, pseudogene
Gene symbol	PRSS42P
Synonyms (NCBI Gene)	PRSS42TESSP2
Chromosome	3
Chromosome location	3p21.31
Summary	This gene encodes a member of a cluster of testis-specific serine proteases. The orthologous mouse gene is expressed during meiosis in pachytene spermatocytes and is required for germ cell survival. This human locus is represented as a pseudogene because

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q7Z5A4

Protein name

Putative serine protease 42 (EC 3.4.21.-) (Serine protease 42, pseudogene) (Testis serine protease 2)

Protein function

Plays a role in spermatogenesis. Involved in germ cell survival during meiosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	80 → 293	Trypsin	Domain

Sequence

MSSGGGSRGLLAWLLLLQPWPGQNWAGMAAPRLPSPLLSEEGGENPEASPAPGPEAGPPL
NLFTSFPGDSLLCGRTPLRIVGGVDAEEGRWPWQVSVRTKGRHICGGTLVTATWVLTAGH
CISSRFHYSVKMGDRSVYNENTSVVVSVQRAFVHPKFSTVTTIRNDLALLQLQHPVNFTS
NIQPICIPQENFQVEGRTRCWVTGWGKTPEREKLASEILQDVDQYIMCYEECNKIIQKAL
SSTKDVIIKGMVCGYKEQGKDSCQGDSGGRLACEYNDTWVQVGIVSWGIGCGR

Sequence length

293

Interactions

View interactions

Related Genes Genes most often co-reported with PRSS42P across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PRSS42P.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PRSS42P (see Related Genes above), that are NOT already directly curated for PRSS42P itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PRSS42P.

PRSS42P (serine protease 42, pseudogene)

Bookmark This Gene