PRSS3P2 (PRSS3 pseudogene 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 154754
Gene name PRSS3 pseudogene 2
Gene symbol PRSS3P2
Synonyms (NCBI Gene)
T6TRY6
Chromosome 7
Chromosome location 7q34
Summary Although this locus appears to encode a protein similar to trypsinogen, the locus is thought to be a transcribed pseudogene. ESTs support its transcription, but expression of its predicted protein has not been observed. Its predicted protein sequence diff
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0006508 Process Proteolysis IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 43788 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHM4
Protein name Putative trypsin-6 (EC 3.4.21.4) (Serine protease 3 pseudogene 2) (Trypsinogen C)
Protein function May regulate cell migration.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 24 → 239 Trypsin Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in metastasing in non small cell lung tumors, leading to an enhanced cell migration. {ECO:0000269|PubMed:15313892}.
Sequence 
MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVS
AGHCYKPHIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNRIILNNDIMLIKLSTPAVIN
AHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIK
DTIAANS
Sequence length 247
Interactions View interactions

No strongly related genes found yet for PRSS3P2.

No additional diseases found yet through genes similar to PRSS3P2.