PRSS38 (serine protease 38)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 339501
• Gene name: Serine protease 38
• Gene symbol: PRSS38
• Synonyms (NCBI Gene): MPN2
• Chromosome: 1
• Chromosome location: 1q42.13

miRNA Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646256	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT646257	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT646254	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT646255	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT646253	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646252	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646251	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT646250	hsa-miR-623	HITS-CLIP	23824327
MIRT646249	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646248	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646247	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646246	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT646256	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT646257	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT646254	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT646255	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT646253	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646252	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646251	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT646250	hsa-miR-623	HITS-CLIP	23824327
MIRT646249	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646248	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646247	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT646246	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT1268558	hsa-miR-125a-5p	CLIP-seq
MIRT1268559	hsa-miR-125b	CLIP-seq
MIRT1268560	hsa-miR-204	CLIP-seq
MIRT1268561	hsa-miR-211	CLIP-seq
MIRT1268562	hsa-miR-4287	CLIP-seq
MIRT1268563	hsa-miR-4319	CLIP-seq
MIRT1268564	hsa-miR-4469	CLIP-seq
MIRT1268565	hsa-miR-4685-3p	CLIP-seq
MIRT1268566	hsa-miR-4713-5p	CLIP-seq
MIRT1268567	hsa-miR-4732-3p	CLIP-seq
MIRT1268568	hsa-miR-670	CLIP-seq
MIRT2078908	hsa-miR-3919	CLIP-seq
MIRT2078909	hsa-miR-3977	CLIP-seq
MIRT2078910	hsa-miR-4436a	CLIP-seq
MIRT2078911	hsa-miR-4756-3p	CLIP-seq
MIRT2305140	hsa-miR-3690	CLIP-seq
MIRT2305141	hsa-miR-378	CLIP-seq
MIRT2305142	hsa-miR-378b	CLIP-seq
MIRT2305143	hsa-miR-378c	CLIP-seq
MIRT2305144	hsa-miR-378d	CLIP-seq
MIRT2305145	hsa-miR-378e	CLIP-seq
MIRT2305146	hsa-miR-378f	CLIP-seq
MIRT2305147	hsa-miR-378h	CLIP-seq
MIRT2305148	hsa-miR-378i	CLIP-seq
MIRT2078908	hsa-miR-3919	CLIP-seq
MIRT2078909	hsa-miR-3977	CLIP-seq
MIRT2305149	hsa-miR-422a	CLIP-seq
MIRT2305150	hsa-miR-4254	CLIP-seq
MIRT2078911	hsa-miR-4756-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A1L453
• Protein name: Serine protease 38 (EC 3.4.21.-) (Marapsin-2)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	60 → 288	Trypsin	Domain

• Sequence:

  MAAPASVMGPLGPSALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKI
  LGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNL
  RVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTS
  ANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTV
  CEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIEITPTPAQ
  PAPALSPALGPTLSVLMAMLAGWSVL

• Sequence length: 326

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for PRSS38.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRSS38.