PRSS37 (serine protease 37)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 136242
• Gene name: Serine protease 37
• Gene symbol: PRSS37
• Synonyms (NCBI Gene): TRYX2
• Chromosome: 7
• Chromosome location: 7q34

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IDA	27649891
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006508	Process	Proteolysis	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	ISS
GO:0008354	Process	Germ cell migration	IEA
GO:0016477	Process	Cell migration	ISS
GO:0030141	Component	Secretory granule	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IEA
GO:0051604	Process	Protein maturation	ISS
GO:0070613	Process	Regulation of protein processing	IMP	27649891
GO:1905516	Process	Positive regulation of fertilization	IEA
GO:1905516	Process	Positive regulation of fertilization	ISS
GO:2000243	Process	Positive regulation of reproductive process	IEA
GO:2000344	Process	Positive regulation of acrosome reaction	IBA
GO:2000344	Process	Positive regulation of acrosome reaction	IMP	27649891

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A4D1T9
• Protein name: Probable inactive serine protease 37 (Probable inactive trypsin-X2)
• Protein function: Plays a role in male fertility (By similarity). May have a role in sperm migration or binding to zona-intact eggs (By similarity). Involved in the activation of the proacrosin/acrosin system (PubMed:27649891). {ECO:0000250|UniProtKB:Q9DAA4, ECO:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	18 → 228	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific (PubMed:27649891). Expressed in spermatids (at protein level) (PubMed:27649891). {ECO:0000269|PubMed:27649891}.
• Sequence:

  MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN
  LKVMLGNFKSRVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTL
  ATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKF
  VKVFSRIFGEVAVATVICKDKLQGIEVGHFMGGDVGIYTNVYKYVSWIENTAKDK

• Sequence length: 235

Related Genes

No strongly related genes found yet for PRSS37.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRSS37.