PRSS33 (serine protease 33)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 260429
• Gene name: Serine protease 33
• Gene symbol: PRSS33
• Synonyms (NCBI Gene): EOS
• Chromosome: 16
• Chromosome location: 16p13.3

miRNA Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1268551	hsa-miR-1207-3p	CLIP-seq
MIRT1268552	hsa-miR-149	CLIP-seq
MIRT1268553	hsa-miR-3126-5p	CLIP-seq
MIRT1268554	hsa-miR-4419a	CLIP-seq
MIRT1268555	hsa-miR-4510	CLIP-seq
MIRT1268556	hsa-miR-4530	CLIP-seq
MIRT1268557	hsa-miR-646	CLIP-seq
MIRT2078896	hsa-miR-1827	CLIP-seq
MIRT2078897	hsa-miR-205	CLIP-seq
MIRT2078898	hsa-miR-298	CLIP-seq
MIRT2078899	hsa-miR-3127-5p	CLIP-seq
MIRT2078900	hsa-miR-3154	CLIP-seq
MIRT2078901	hsa-miR-4267	CLIP-seq
MIRT2078902	hsa-miR-4448	CLIP-seq
MIRT2078903	hsa-miR-4757-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	12795636
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	12795636
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 613797
• HGNC: 30405
• e!Ensembl: ENSG00000103355

Protein

• UniProt ID: Q8NF86
• Protein name: Serine protease 33 (EC 3.4.21.-) (Serine protease EOS)
• Protein function: Serine protease that has amidolytic activity, cleaving its substrates before Arg residues.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	37 → 274	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in macrophages. Present in the spleen, small and large intestine, lung and brain (at protein level). Highly expressed in peripheral leukocytes, ovary, retina, spleen and stomach. Moderately expressed in thymus,
• Sequence:

  MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAH
  VCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSE
  DGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPL
  QGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQS
  GSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF

• Sequence length: 280

Related Genes

No strongly related genes found yet for PRSS33.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRSS33.