PRSS27 (serine protease 27)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 83886
• Gene name: Serine protease 27
• Gene symbol: PRSS27
• Synonyms (NCBI Gene): CAPH2, MPN
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene is located within a large protease gene cluster on chromosome 16. It belongs to the group-1 subfamily of serine proteases. The encoded protein is a secreted tryptic serine protease and is expressed mainly in the pancreas. Alternative splicing re

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2078883	hsa-miR-3151	CLIP-seq
MIRT2078884	hsa-miR-3163	CLIP-seq
MIRT2078885	hsa-miR-4283	CLIP-seq
MIRT2078886	hsa-miR-4284	CLIP-seq
MIRT2078887	hsa-miR-4299	CLIP-seq
MIRT2078888	hsa-miR-4437	CLIP-seq
MIRT2078889	hsa-miR-4456	CLIP-seq
MIRT2078890	hsa-miR-4489	CLIP-seq
MIRT2078891	hsa-miR-513a-5p	CLIP-seq
MIRT2078892	hsa-miR-541	CLIP-seq
MIRT2078893	hsa-miR-548q	CLIP-seq
MIRT2078894	hsa-miR-552	CLIP-seq
MIRT2078895	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 608018
• HGNC: 15475
• e!Ensembl: ENSG00000172382

Protein

• UniProt ID: Q9BQR3
• Protein name: Serine protease 27 (EC 3.4.21.-) (Marapsin) (Pancreasin)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	35 → 272	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the pancreas. {ECO:0000269|PubMed:12441343}.
• Sequence:

  MRRPAAVPLLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFC
  GGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTA
  SSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQK
  LAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQS
  WLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK

• Sequence length: 290

Related Genes

No strongly related genes found yet for PRSS27.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRSS27.