Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	574414
Gene name	Proline rich 9
Gene symbol	PRR9
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q21.3

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT1267182	hsa-miR-3135b	CLIP-seq
MIRT1267183	hsa-miR-3161	CLIP-seq
MIRT1267184	hsa-miR-3165	CLIP-seq
MIRT1267185	hsa-miR-320e	CLIP-seq
MIRT1267186	hsa-miR-323-5p	CLIP-seq
MIRT1267187	hsa-miR-3689d	CLIP-seq
MIRT1267188	hsa-miR-3924	CLIP-seq
MIRT1267189	hsa-miR-4434	CLIP-seq
MIRT1267190	hsa-miR-4516	CLIP-seq
MIRT1267191	hsa-miR-4531	CLIP-seq
MIRT1267192	hsa-miR-4661-3p	CLIP-seq
MIRT1267193	hsa-miR-4773	CLIP-seq
MIRT1267194	hsa-miR-4795-3p	CLIP-seq
MIRT1267195	hsa-miR-596	CLIP-seq
MIRT1267196	hsa-miR-651	CLIP-seq
MIRT1267197	hsa-miR-876-3p	CLIP-seq
MIRT2304934	hsa-miR-146a	CLIP-seq
MIRT2304935	hsa-miR-146b-5p	CLIP-seq
MIRT2304936	hsa-miR-3177-5p	CLIP-seq
MIRT2304937	hsa-miR-4719	CLIP-seq
MIRT2304938	hsa-miR-589	CLIP-seq
MIRT1267184	hsa-miR-3165	CLIP-seq
MIRT1267186	hsa-miR-323-5p	CLIP-seq
MIRT1267187	hsa-miR-3689d	CLIP-seq
MIRT1267197	hsa-miR-876-3p	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein name

Proline-rich protein 9

Family and domains

Sequence

MSFSEQQCKQPCVPPPCLPKTQEQCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQES
SQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPGKGK

Sequence length

116

Interactions

View interactions

Related Genes Genes most often co-reported with PRR9 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PRR9.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PRR9 (see Related Genes above), that are NOT already directly curated for PRR9 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PRR9.

PRR9 (proline rich 9)