PRR7 (proline rich 7, synaptic)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80758
• Gene name: Proline rich 7, synaptic
• Gene symbol: PRR7
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q35.3

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030056	hsa-miR-26b-5p	Microarray	19088304
MIRT039390	hsa-miR-421	CLASH	23622248
MIRT1267173	hsa-miR-1228	CLIP-seq
MIRT1267174	hsa-miR-194	CLIP-seq
MIRT1267175	hsa-miR-329	CLIP-seq
MIRT1267176	hsa-miR-362-3p	CLIP-seq
MIRT1267177	hsa-miR-371b-5p	CLIP-seq
MIRT1267178	hsa-miR-377	CLIP-seq
MIRT1267179	hsa-miR-4698	CLIP-seq
MIRT1267180	hsa-miR-4795-3p	CLIP-seq
MIRT1267181	hsa-miR-495	CLIP-seq

Gene ontology (GO) Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	27458189, 33961781, 35044719
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21460222
GO:0006356	Process	Regulation of transcription by RNA polymerase I	IEA
GO:0006356	Process	Regulation of transcription by RNA polymerase I	IMP	27458189
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0036041	Function	Long-chain fatty acid binding	IMP	21460222
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	21460222
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	27458189
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046632	Process	Alpha-beta T cell differentiation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	21460222
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IBA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IBA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	21460222

Other IDs

• MIM: 618306
• HGNC: 28130
• e!Ensembl: ENSG00000131188

Protein

• UniProt ID: Q8TB68
• Protein name: Proline-rich protein 7 (Synaptic proline-rich membrane protein)
• Protein function: Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (By similarity). Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity
• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in brain tissue including the hippocampus, and moderately expressed in esophagus, trachea, lung, ovary, cervix, prostate, testes, thyroid, thymus, lymph nodes and peripheral blood lymphocytes. {ECO:0000269|PubMed:214
• Sequence:

  MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLE
  LEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH
  ALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKI
  VTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVF
  PSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

• Sequence length: 274

Related Genes

No strongly related genes found yet for PRR7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRR7.