PRR34 (PRR34 long non-coding RNA)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55267
Gene name PRR34 long non-coding RNA
Gene symbol PRR34
Synonyms (NCBI Gene)
C22orf26
Chromosome 22
Chromosome location 22q13.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 25606 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NV39
Protein name Proline-rich protein 34
Family and domains
Sequence 
MPASATAAWHCPPLCLPPLPASAPTSPPNPATRPAPGPGRRARCPQSAHPAPTRGALTFW
APGSWPRVLLVPRSPGPVLRAPRLPHPAARARRRAWHGARLPGSPARAGRTFQRGLVSNS
WAHAIFLPRPPNVLELQV
Sequence length 138
Interactions View interactions

No strongly related genes found yet for PRR34.

No additional diseases found yet through genes similar to PRR34.