PRORY (PRORY Y-linked lncRNA)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100533178
Gene name PRORY Y-linked lncRNA
Gene symbol PRORY
Synonyms (NCBI Gene)
CYorf17
Chromosome Y
Chromosome location Yq11.223
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 38732 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H606
Protein name Proline-rich protein, Y-linked
Family and domains
Sequence 
MMRRSPSGLKSPRVSQGRKPRDPESLLFLRCCLGSEPHNLSSLLSPEAGQEPLPKLLPQP
LAGHAAWGIHGVPTSLLLAGECWGQGMAVPADPPPASPYRTSPRPPPGPLPRYRPQQHLL
LPLGRLHALCPGCPLQQSLQFERGTLSAPRLWSWMKLETIILSKLSQGQKTKHRMFSLIS
ES
Sequence length 182
Interactions View interactions

No strongly related genes found yet for PRORY.

No additional diseases found yet through genes similar to PRORY.