PRM3 (protamine 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 58531
Gene name Protamine 3
Gene symbol PRM3
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p13.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0005694 Component Chromosome IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NNZ6
Protein name Protamine-3 (Sperm protamine P3)
Protein function Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex (By similarity).
Family and domains
Sequence 
MGSRCAKLNTGQSPGHSPGHSTGHGRGHESSMKKLMACVSQDNFSLSSAGEEEEEEEEEG
EEEEKEELPVQGKLLLLEPERQEEGQKDNAEAQQSPEPKQTPS
Sequence length 103
Interactions View interactions

No strongly related genes found yet for PRM3.

No additional diseases found yet through genes similar to PRM3.