PRM2 (protamine 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5620
• Gene name: Protamine 2
• Gene symbol: PRM2
• Synonyms (NCBI Gene): CT94.2
• Chromosome: 16
• Chromosome location: 16p13.13
• Summary: Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis, and are the major DNA-binding proteins in the nucleus of sperm in many vertebrates. They package the sperm DNA into a highly condensed complex in a v

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1264499	hsa-miR-125a-3p	CLIP-seq
MIRT1264500	hsa-miR-3665	CLIP-seq
MIRT1264501	hsa-miR-4736	CLIP-seq
MIRT2304395	hsa-miR-3164	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2081589
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS	2081589
GO:0005694	Component	Chromosome	IEA
GO:0006997	Process	Nucleus organization	IBA
GO:0006997	Process	Nucleus organization	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007283	Process	Spermatogenesis	TAS	2081589
GO:0007286	Process	Spermatid development	IBA
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0008270	Function	Zinc ion binding	IDA	2243113
GO:0030154	Process	Cell differentiation	IEA
GO:0030261	Process	Chromosome condensation	IEA
GO:0046870	Function	Cadmium ion binding	IDA	2243113
GO:0051276	Process	Chromosome organization	IEA
GO:0051276	Process	Chromosome organization	TAS	2081589

Other IDs

• MIM: 182890
• HGNC: 9448
• e!Ensembl: ENSG00000122304

Protein

• UniProt ID: P04554
• Protein name: Protamine-2 (Sperm histone P2) (Sperm protamine P2) [Cleaved into: Basic nuclear protein HPI1; Basic nuclear protein HPI2; Basic nuclear protein HPS1; Basic nuclear protein HPS2; Sperm histone HP4 (Sperm protamine P4); Sperm histone HP2 (Sperm protamine P
• Protein function: Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00841	Protamine_P2	1 → 91	Sperm histone P2	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis.
• Sequence:

  MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSR
  RRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH

• Sequence length: 102

Related Genes

No strongly related genes found yet for PRM2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRM2.