PRLH (prolactin releasing hormone)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51052
• Gene name: Prolactin releasing hormone
• Gene symbol: PRLH
• Synonyms (NCBI Gene): PRH, PRRP
• Chromosome: 2
• Chromosome location: 2q37.3

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001894	Process	Tissue homeostasis	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0002023	Process	Reduction of food intake in response to dietary excess	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	9607765
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006112	Process	Energy reserve metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007631	Process	Feeding behavior	IBA
GO:0007631	Process	Feeding behavior	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0031861	Function	Prolactin-releasing peptide receptor binding	IBA
GO:0031861	Function	Prolactin-releasing peptide receptor binding	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0048483	Process	Autonomic nervous system development	IEA

Other IDs

• MIM: 602663
• HGNC: 17945
• e!Ensembl: ENSG00000071677

Protein

• UniProt ID: P81277
• Protein name: Prolactin-releasing peptide (PrRP) (Prolactin-releasing hormone) [Cleaved into: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]
• Protein function: Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
• PDB: 8ZPS , 8ZPT , 9K26 , 9K27
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15172	Prolactin_RP	24 → 68	Prolactin-releasing peptide	Family

• Tissue specificity: TISSUE SPECIFICITY: Medulla oblongata and hypothalamus. {ECO:0000269|PubMed:10498338}.
• Sequence:

  MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
  GDVPKPGLRPRLTCFPLEGGAMSSQDG

• Sequence length: 87

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Peptide ligand-binding receptors
Hormone signaling

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PRLHR 2 shared pathwaysHormone signaling, Peptide ligand-binding receptors Related via 2 shared pathways including Hormone signaling, Peptide ligand-binding receptors. MLNR 2 shared pathwaysHormone signaling, Peptide ligand-binding receptors Related via 2 shared pathways including Hormone signaling, Peptide ligand-binding receptors. MLN 2 shared pathwaysHormone signaling, Peptide ligand-binding receptors Related via 2 shared pathways including Hormone signaling, Peptide ligand-binding receptors. OPRK1 2 shared pathwaysHormone signaling, Peptide ligand-binding receptors Related via 2 shared pathways including Hormone signaling, Peptide ligand-binding receptors. OPRL1 2 shared pathwaysHormone signaling, Peptide ligand-binding receptors Related via 2 shared pathways including Hormone signaling, Peptide ligand-binding receptors.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PRLHR	0	[]	2	["Hormone signaling","Peptide ligand-binding receptors"]	0	[]
MLNR	0	[]	2	["Hormone signaling","Peptide ligand-binding receptors"]	0	[]
MLN	0	[]	2	["Hormone signaling","Peptide ligand-binding receptors"]	0	[]
OPRK1	0	[]	2	["Hormone signaling","Peptide ligand-binding receptors"]	0	[]
OPRL1	0	[]	2	["Hormone signaling","Peptide ligand-binding receptors"]	0	[]

Diseases Linked via Similar Genes

Substance abuse Linked via 3 of 5 related genesMLN, OPRK1, OPRL1 Diabetes mellitus type 2 Linked via 2 of 5 related genesMLNR, OPRL1 Coronary artery disease Linked via 2 of 5 related genesMLN, OPRL1 Cardiac arrhythmia Linked via 2 of 5 related genesOPRK1, OPRL1 Hypertension Linked via 1 of 5 related genesPRLHR

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Substance abuse	3	["MLN","OPRK1","OPRL1"]
Diabetes mellitus type 2	2	["MLNR","OPRL1"]
Coronary artery disease	2	["MLN","OPRL1"]
Cardiac arrhythmia	2	["OPRK1","OPRL1"]
Hypertension	1	["PRLHR"]