PRKY (protein kinase Y-linked (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5616
Gene name Protein kinase Y-linked (pseudogene)
Gene symbol PRKY
Synonyms (NCBI Gene)
PRKXP3PRKYP
Chromosome Y
Chromosome location Yp11.2
Summary This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity TAS 9154127
GO:0004691 Function CAMP-dependent protein kinase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
400008 9444 ENSG00000293442
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43930
Protein name Putative serine/threonine-protein kinase PRKY (EC 2.7.11.1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 50 → 272 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12815422}.
Sequence 
MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEER
FLYMLMEYVPGGELFSYLRNRGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILL
DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM
Sequence length 277
Interactions View interactions

No strongly related genes found yet for PRKY.

No additional diseases found yet through genes similar to PRKY.