Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5571
Gene name	Protein kinase AMP-activated non-catalytic subunit gamma 1
Gene symbol	PRKAG1
Synonyms (NCBI Gene)	AMPKG
Chromosome	12
Chromosome location	12q13.12
Summary	The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

194

Show/Hide all (194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022607	hsa-miR-124-3p	Microarray	18668037
MIRT023779	hsa-miR-1-3p	Proteomics	18668040
MIRT045971	hsa-miR-125b-5p	CLASH	23622248
MIRT037198	hsa-miR-877-3p	CLASH	23622248
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT573776	hsa-miR-4729	PAR-CLIP	20371350
MIRT573775	hsa-miR-6748-3p	PAR-CLIP	20371350
MIRT573774	hsa-miR-4421	PAR-CLIP	20371350
MIRT573773	hsa-miR-5699-3p	PAR-CLIP	20371350
MIRT573772	hsa-miR-215-3p	PAR-CLIP	20371350
MIRT573771	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT573770	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT573769	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT573768	hsa-miR-5696	PAR-CLIP	20371350
MIRT573767	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT573766	hsa-miR-3064-3p	PAR-CLIP	20371350
MIRT573765	hsa-miR-4715-3p	PAR-CLIP	20371350
MIRT573764	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT573763	hsa-miR-8061	PAR-CLIP	20371350
MIRT573762	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT573761	hsa-miR-4776-3p	PAR-CLIP	20371350
MIRT439904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT573776	hsa-miR-4729	PAR-CLIP	20371350
MIRT573775	hsa-miR-6748-3p	PAR-CLIP	20371350
MIRT573774	hsa-miR-4421	PAR-CLIP	20371350
MIRT573773	hsa-miR-5699-3p	PAR-CLIP	20371350
MIRT573772	hsa-miR-215-3p	PAR-CLIP	20371350
MIRT573771	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT573770	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT573769	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT573768	hsa-miR-5696	PAR-CLIP	20371350
MIRT573767	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT573766	hsa-miR-3064-3p	PAR-CLIP	20371350
MIRT573765	hsa-miR-4715-3p	PAR-CLIP	20371350
MIRT573764	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT573763	hsa-miR-8061	PAR-CLIP	20371350
MIRT573762	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT573761	hsa-miR-4776-3p	PAR-CLIP	20371350
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT1262379	hsa-miR-1297	CLIP-seq
MIRT1262380	hsa-miR-1305	CLIP-seq
MIRT1262381	hsa-miR-26a	CLIP-seq
MIRT1262382	hsa-miR-26b	CLIP-seq
MIRT1262383	hsa-miR-297	CLIP-seq
MIRT1262384	hsa-miR-3929	CLIP-seq
MIRT1262385	hsa-miR-4316	CLIP-seq
MIRT1262386	hsa-miR-4419b	CLIP-seq
MIRT1262387	hsa-miR-4465	CLIP-seq
MIRT1262388	hsa-miR-4478	CLIP-seq
MIRT1262389	hsa-miR-4489	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT1262393	hsa-miR-4766-5p	CLIP-seq
MIRT1262394	hsa-miR-4794	CLIP-seq
MIRT1262395	hsa-miR-498	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT1262398	hsa-miR-555	CLIP-seq
MIRT1262399	hsa-miR-561	CLIP-seq
MIRT1262400	hsa-miR-567	CLIP-seq
MIRT1262401	hsa-miR-645	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262403	hsa-miR-892b	CLIP-seq
MIRT1262404	hsa-miR-1207-5p	CLIP-seq
MIRT1262405	hsa-miR-1909	CLIP-seq
MIRT1262406	hsa-miR-3144-5p	CLIP-seq
MIRT1262407	hsa-miR-4725-5p	CLIP-seq
MIRT1262408	hsa-miR-4763-3p	CLIP-seq
MIRT1262409	hsa-miR-504	CLIP-seq
MIRT2077355	hsa-miR-1231	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT2077356	hsa-miR-1303	CLIP-seq
MIRT1262406	hsa-miR-3144-5p	CLIP-seq
MIRT2077357	hsa-miR-383	CLIP-seq
MIRT2077358	hsa-miR-4288	CLIP-seq
MIRT1262385	hsa-miR-4316	CLIP-seq
MIRT2077359	hsa-miR-4450	CLIP-seq
MIRT2077360	hsa-miR-4667-5p	CLIP-seq
MIRT2077361	hsa-miR-4700-5p	CLIP-seq
MIRT1262407	hsa-miR-4725-5p	CLIP-seq
MIRT1262393	hsa-miR-4766-5p	CLIP-seq
MIRT2077362	hsa-miR-4797-5p	CLIP-seq
MIRT1262409	hsa-miR-504	CLIP-seq
MIRT1262398	hsa-miR-555	CLIP-seq
MIRT1262399	hsa-miR-561	CLIP-seq
MIRT2077363	hsa-miR-632	CLIP-seq
MIRT2077364	hsa-miR-637	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT2600746	hsa-miR-1827	CLIP-seq
MIRT2600747	hsa-miR-218	CLIP-seq
MIRT2600748	hsa-miR-2467-3p	CLIP-seq
MIRT2600749	hsa-miR-296-3p	CLIP-seq
MIRT2600750	hsa-miR-3127-5p	CLIP-seq
MIRT2600751	hsa-miR-3185	CLIP-seq
MIRT2600752	hsa-miR-3612	CLIP-seq
MIRT2600753	hsa-miR-3918	CLIP-seq
MIRT2600754	hsa-miR-3942-5p	CLIP-seq
MIRT2600755	hsa-miR-4279	CLIP-seq
MIRT2600756	hsa-miR-4426	CLIP-seq
MIRT2600757	hsa-miR-4443	CLIP-seq
MIRT2077359	hsa-miR-4450	CLIP-seq
MIRT2600758	hsa-miR-4534	CLIP-seq
MIRT2600759	hsa-miR-4647	CLIP-seq
MIRT2600760	hsa-miR-4662b	CLIP-seq
MIRT2077360	hsa-miR-4667-5p	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT2077361	hsa-miR-4700-5p	CLIP-seq
MIRT2600761	hsa-miR-4703-5p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT2600762	hsa-miR-4802-5p	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT2600763	hsa-miR-548c-3p	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT2077364	hsa-miR-637	CLIP-seq
MIRT2600764	hsa-miR-650	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT2600746	hsa-miR-1827	CLIP-seq
MIRT2600747	hsa-miR-218	CLIP-seq
MIRT2600748	hsa-miR-2467-3p	CLIP-seq
MIRT2600749	hsa-miR-296-3p	CLIP-seq
MIRT2600750	hsa-miR-3127-5p	CLIP-seq
MIRT2600751	hsa-miR-3185	CLIP-seq
MIRT2600752	hsa-miR-3612	CLIP-seq
MIRT2600753	hsa-miR-3918	CLIP-seq
MIRT2600754	hsa-miR-3942-5p	CLIP-seq
MIRT2600755	hsa-miR-4279	CLIP-seq
MIRT2600756	hsa-miR-4426	CLIP-seq
MIRT2600757	hsa-miR-4443	CLIP-seq
MIRT2600758	hsa-miR-4534	CLIP-seq
MIRT2600759	hsa-miR-4647	CLIP-seq
MIRT2600760	hsa-miR-4662b	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT2600761	hsa-miR-4703-5p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT2600762	hsa-miR-4802-5p	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT2600763	hsa-miR-548c-3p	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT2600764	hsa-miR-650	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004691	Function	CAMP-dependent protein kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16306228, 17028174, 18403135, 18480843, 20562859, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 28514442, 28561066, 31515488, 32296183, 32707033, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9693118
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006110	Process	Regulation of glycolytic process	IBA
GO:0006110	Process	Regulation of glycolytic process	TAS	8663446
GO:0006468	Process	Protein phosphorylation	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007165	Process	Signal transduction	TAS
GO:0007283	Process	Spermatogenesis	TAS
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	8663446
GO:0016020	Component	Membrane	HDA	19946888
GO:0016208	Function	AMP binding	IBA
GO:0016208	Function	AMP binding	IEA
GO:0016208	Function	AMP binding	ISS
GO:0016208	Function	AMP binding	TAS
GO:0019887	Function	Protein kinase regulator activity	IBA
GO:0019887	Function	Protein kinase regulator activity	IDA	24563466
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019887	Function	Protein kinase regulator activity	ISS
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0019901	Function	Protein kinase binding	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IPI	9693118, 25412657, 29480465, 29657085
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0031669	Process	Cellular response to nutrient levels	IDA	25412657, 30478170
GO:0031669	Process	Cellular response to nutrient levels	NAS	9693118, 29657085
GO:0032991	Component	Protein-containing complex	IEA
GO:0042149	Process	Cellular response to glucose starvation	IBA
GO:0043531	Function	ADP binding	IEA
GO:0043531	Function	ADP binding	ISS
GO:0043609	Process	Regulation of carbon utilization	IBA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045722	Process	Positive regulation of gluconeogenesis	IBA
GO:0051170	Process	Import into nucleus	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS

MIM	HGNC	e!Ensembl
602742	9385	ENSG00000181929

P54619

Protein name

5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)

Protein function

AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:21680840, PubMed:24563466). In response to reduction of intracellular ATP leve

PDB

2UV4 , 2UV5 , 2UV6 , 2UV7 , 4CFE , 4CFF , 4RER , 4REW , 4ZHX , 5EZV , 5ISO , 6B1U , 6B2E , 6C9F , 6C9G , 6C9H , 6C9J , 7JHG , 7JHH , 7JIJ , 7M74 , 7MYJ , 8BIK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00571	CBS	120 → 178	CBS domain	Domain
PF00571	CBS	185 → 252	CBS domain	Domain
PF00571	CBS	269 → 324	CBS domain	Domain

Sequence

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP

Sequence length

331

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Neoplasms	Neoplasms	BEFREE	30856283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22897928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1)