Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5564
Gene name	Protein kinase AMP-activated non-catalytic subunit beta 1
Gene symbol	PRKAB1
Synonyms (NCBI Gene)	AMPKHAMPKb
Chromosome	12
Chromosome location	12q24.23
Summary	The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

405

Show/Hide all (405)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004527	hsa-miR-122-5p	Luciferase reporter assay	16459310
MIRT053237	hsa-miR-148b-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23171948
MIRT719926	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT719927	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT719926	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT719925	hsa-miR-665	HITS-CLIP	19536157
MIRT719924	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719923	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT719922	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719921	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT650661	hsa-miR-4469	HITS-CLIP	19536157
MIRT719920	hsa-miR-1260a	HITS-CLIP	19536157
MIRT719919	hsa-miR-1260b	HITS-CLIP	19536157
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719917	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT719918	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT650663	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650661	hsa-miR-4469	HITS-CLIP	23824327
MIRT650659	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT650658	hsa-miR-6817-5p	HITS-CLIP	23824327
MIRT650657	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT650656	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650654	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650653	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT650652	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT650651	hsa-miR-578	HITS-CLIP	23824327
MIRT735797	hsa-miR-802	Luciferase reporter assayWestern blottingqRT-PCR	33391522
MIRT719926	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT719927	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT719926	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT719925	hsa-miR-665	HITS-CLIP	19536157
MIRT719924	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT719923	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT719922	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719921	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT650661	hsa-miR-4469	HITS-CLIP	19536157
MIRT719920	hsa-miR-1260a	HITS-CLIP	19536157
MIRT719919	hsa-miR-1260b	HITS-CLIP	19536157
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT719917	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT719918	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT650663	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650661	hsa-miR-4469	HITS-CLIP	23824327
MIRT650659	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT650658	hsa-miR-6817-5p	HITS-CLIP	23824327
MIRT650657	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT650656	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650654	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650653	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT650652	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT650651	hsa-miR-578	HITS-CLIP	23824327
MIRT1262041	hsa-miR-1200	CLIP-seq
MIRT1262042	hsa-miR-1225-5p	CLIP-seq
MIRT1262043	hsa-miR-133a	CLIP-seq
MIRT1262044	hsa-miR-133b	CLIP-seq
MIRT1262045	hsa-miR-186	CLIP-seq
MIRT1262046	hsa-miR-18a	CLIP-seq
MIRT1262047	hsa-miR-18b	CLIP-seq
MIRT1262048	hsa-miR-2467-3p	CLIP-seq
MIRT1262049	hsa-miR-3120-3p	CLIP-seq
MIRT1262050	hsa-miR-3133	CLIP-seq
MIRT1262051	hsa-miR-378g	CLIP-seq
MIRT1262052	hsa-miR-4257	CLIP-seq
MIRT1262053	hsa-miR-431	CLIP-seq
MIRT1262054	hsa-miR-4324	CLIP-seq
MIRT1262055	hsa-miR-4639-5p	CLIP-seq
MIRT1262056	hsa-miR-4688	CLIP-seq
MIRT1262057	hsa-miR-4727-3p	CLIP-seq
MIRT1262058	hsa-miR-4735-3p	CLIP-seq
MIRT1262059	hsa-miR-4761-5p	CLIP-seq
MIRT1262060	hsa-miR-486-3p	CLIP-seq
MIRT1262061	hsa-miR-490-3p	CLIP-seq
MIRT1262062	hsa-miR-544b	CLIP-seq
MIRT1262063	hsa-miR-642a	CLIP-seq
MIRT1262064	hsa-miR-9	CLIP-seq
MIRT1262042	hsa-miR-1225-5p	CLIP-seq
MIRT2077207	hsa-miR-1267	CLIP-seq
MIRT2077208	hsa-miR-141	CLIP-seq
MIRT2077209	hsa-miR-200a	CLIP-seq
MIRT2077210	hsa-miR-361-3p	CLIP-seq
MIRT1262051	hsa-miR-378g	CLIP-seq
MIRT2077211	hsa-miR-4254	CLIP-seq
MIRT2077212	hsa-miR-4267	CLIP-seq
MIRT2077213	hsa-miR-4292	CLIP-seq
MIRT2077214	hsa-miR-4308	CLIP-seq
MIRT2077215	hsa-miR-4537	CLIP-seq
MIRT1262057	hsa-miR-4727-3p	CLIP-seq
MIRT1262061	hsa-miR-490-3p	CLIP-seq
MIRT2077216	hsa-miR-653	CLIP-seq
MIRT2303738	hsa-miR-130a	CLIP-seq
MIRT2303739	hsa-miR-130b	CLIP-seq
MIRT2077208	hsa-miR-141	CLIP-seq
MIRT2077209	hsa-miR-200a	CLIP-seq
MIRT2303740	hsa-miR-203	CLIP-seq
MIRT1262048	hsa-miR-2467-3p	CLIP-seq
MIRT2303741	hsa-miR-301a	CLIP-seq
MIRT2303742	hsa-miR-301b	CLIP-seq
MIRT2303743	hsa-miR-3182	CLIP-seq
MIRT2303744	hsa-miR-3194-5p	CLIP-seq
MIRT2303745	hsa-miR-3666	CLIP-seq
MIRT2303746	hsa-miR-3678-3p	CLIP-seq
MIRT2077211	hsa-miR-4254	CLIP-seq
MIRT2077213	hsa-miR-4292	CLIP-seq
MIRT2303747	hsa-miR-4295	CLIP-seq
MIRT2077214	hsa-miR-4308	CLIP-seq
MIRT2303748	hsa-miR-4436b-3p	CLIP-seq
MIRT2303749	hsa-miR-4473	CLIP-seq
MIRT2077215	hsa-miR-4537	CLIP-seq
MIRT2303750	hsa-miR-454	CLIP-seq
MIRT2303751	hsa-miR-4671-3p	CLIP-seq
MIRT2303752	hsa-miR-4685-5p	CLIP-seq
MIRT2303753	hsa-miR-4691-3p	CLIP-seq
MIRT2303754	hsa-miR-4736	CLIP-seq
MIRT2465909	hsa-miR-1205	CLIP-seq
MIRT2465910	hsa-miR-1286	CLIP-seq
MIRT2465911	hsa-miR-28-5p	CLIP-seq
MIRT2465912	hsa-miR-3139	CLIP-seq
MIRT2465913	hsa-miR-3197	CLIP-seq
MIRT2465914	hsa-miR-4722-5p	CLIP-seq
MIRT2465915	hsa-miR-558	CLIP-seq
MIRT2465916	hsa-miR-708	CLIP-seq
MIRT2600457	hsa-miR-103b	CLIP-seq
MIRT2600458	hsa-miR-1185	CLIP-seq
MIRT1262041	hsa-miR-1200	CLIP-seq
MIRT2600459	hsa-miR-1202	CLIP-seq
MIRT2465909	hsa-miR-1205	CLIP-seq
MIRT1262042	hsa-miR-1225-5p	CLIP-seq
MIRT2600460	hsa-miR-1227	CLIP-seq
MIRT2600461	hsa-miR-1245b-3p	CLIP-seq
MIRT2600462	hsa-miR-1252	CLIP-seq
MIRT2600463	hsa-miR-1254	CLIP-seq
MIRT2077207	hsa-miR-1267	CLIP-seq
MIRT2600464	hsa-miR-1269	CLIP-seq
MIRT2600465	hsa-miR-1269b	CLIP-seq
MIRT2600466	hsa-miR-1273	CLIP-seq
MIRT2465910	hsa-miR-1286	CLIP-seq
MIRT1262043	hsa-miR-133a	CLIP-seq
MIRT1262044	hsa-miR-133b	CLIP-seq
MIRT2077208	hsa-miR-141	CLIP-seq
MIRT2600467	hsa-miR-142-5p	CLIP-seq
MIRT2600468	hsa-miR-146a	CLIP-seq
MIRT2600469	hsa-miR-146b-5p	CLIP-seq
MIRT2600470	hsa-miR-181a	CLIP-seq
MIRT2600471	hsa-miR-181b	CLIP-seq
MIRT2600472	hsa-miR-181c	CLIP-seq
MIRT2600473	hsa-miR-181d	CLIP-seq
MIRT1262045	hsa-miR-186	CLIP-seq
MIRT1262046	hsa-miR-18a	CLIP-seq
MIRT1262047	hsa-miR-18b	CLIP-seq
MIRT2600474	hsa-miR-1910	CLIP-seq
MIRT2600475	hsa-miR-1912	CLIP-seq
MIRT2077209	hsa-miR-200a	CLIP-seq
MIRT2303740	hsa-miR-203	CLIP-seq
MIRT2600476	hsa-miR-2110	CLIP-seq
MIRT2600477	hsa-miR-214	CLIP-seq
MIRT1262048	hsa-miR-2467-3p	CLIP-seq
MIRT2465911	hsa-miR-28-5p	CLIP-seq
MIRT2600478	hsa-miR-31	CLIP-seq
MIRT2600479	hsa-miR-3116	CLIP-seq
MIRT1262049	hsa-miR-3120-3p	CLIP-seq
MIRT1262050	hsa-miR-3133	CLIP-seq
MIRT2465912	hsa-miR-3139	CLIP-seq
MIRT2600480	hsa-miR-3150a-3p	CLIP-seq
MIRT2600481	hsa-miR-3153	CLIP-seq
MIRT2600482	hsa-miR-3160-3p	CLIP-seq
MIRT2600483	hsa-miR-3168	CLIP-seq
MIRT2600484	hsa-miR-3176	CLIP-seq
MIRT2303743	hsa-miR-3182	CLIP-seq
MIRT2600485	hsa-miR-3194-3p	CLIP-seq
MIRT2303744	hsa-miR-3194-5p	CLIP-seq
MIRT2465913	hsa-miR-3197	CLIP-seq
MIRT2600486	hsa-miR-320a	CLIP-seq
MIRT2600487	hsa-miR-320b	CLIP-seq
MIRT2600488	hsa-miR-320c	CLIP-seq
MIRT2600489	hsa-miR-320d	CLIP-seq
MIRT2600490	hsa-miR-320e	CLIP-seq
MIRT2600491	hsa-miR-340	CLIP-seq
MIRT2600492	hsa-miR-3605-5p	CLIP-seq
MIRT2600493	hsa-miR-3619-5p	CLIP-seq
MIRT2600494	hsa-miR-3649	CLIP-seq
MIRT2600495	hsa-miR-3652	CLIP-seq
MIRT2600496	hsa-miR-3679-5p	CLIP-seq
MIRT2600497	hsa-miR-3690	CLIP-seq
MIRT1262051	hsa-miR-378g	CLIP-seq
MIRT2600498	hsa-miR-3908	CLIP-seq
MIRT2600499	hsa-miR-3922-3p	CLIP-seq
MIRT2600500	hsa-miR-3938	CLIP-seq
MIRT2600501	hsa-miR-3942-3p	CLIP-seq
MIRT2600502	hsa-miR-3972	CLIP-seq
MIRT2600503	hsa-miR-421	CLIP-seq
MIRT2600504	hsa-miR-4251	CLIP-seq
MIRT2077211	hsa-miR-4254	CLIP-seq
MIRT1262052	hsa-miR-4257	CLIP-seq
MIRT2600505	hsa-miR-4262	CLIP-seq
MIRT2077212	hsa-miR-4267	CLIP-seq
MIRT2600506	hsa-miR-4271	CLIP-seq
MIRT2077213	hsa-miR-4292	CLIP-seq
MIRT2600507	hsa-miR-4303	CLIP-seq
MIRT2077214	hsa-miR-4308	CLIP-seq
MIRT1262053	hsa-miR-431	CLIP-seq
MIRT2600508	hsa-miR-432	CLIP-seq
MIRT1262054	hsa-miR-4324	CLIP-seq
MIRT2600509	hsa-miR-4329	CLIP-seq
MIRT2600510	hsa-miR-4422	CLIP-seq
MIRT2600511	hsa-miR-4429	CLIP-seq
MIRT2600512	hsa-miR-4430	CLIP-seq
MIRT2600513	hsa-miR-4434	CLIP-seq
MIRT2303748	hsa-miR-4436b-3p	CLIP-seq
MIRT2600514	hsa-miR-4487	CLIP-seq
MIRT2600515	hsa-miR-4505	CLIP-seq
MIRT2600516	hsa-miR-4516	CLIP-seq
MIRT2600517	hsa-miR-4529-3p	CLIP-seq
MIRT2600518	hsa-miR-4531	CLIP-seq
MIRT2600519	hsa-miR-4532	CLIP-seq
MIRT2077215	hsa-miR-4537	CLIP-seq
MIRT2600520	hsa-miR-455-3p	CLIP-seq
MIRT2600521	hsa-miR-4638-3p	CLIP-seq
MIRT1262055	hsa-miR-4639-5p	CLIP-seq
MIRT2600522	hsa-miR-4650-5p	CLIP-seq
MIRT2600523	hsa-miR-4668-3p	CLIP-seq
MIRT2600524	hsa-miR-4676-5p	CLIP-seq
MIRT2303752	hsa-miR-4685-5p	CLIP-seq
MIRT1262056	hsa-miR-4688	CLIP-seq
MIRT2600525	hsa-miR-4696	CLIP-seq
MIRT2600526	hsa-miR-4709-3p	CLIP-seq
MIRT2600527	hsa-miR-4709-5p	CLIP-seq
MIRT2600528	hsa-miR-4722-3p	CLIP-seq
MIRT2465914	hsa-miR-4722-5p	CLIP-seq
MIRT2600529	hsa-miR-4725-3p	CLIP-seq
MIRT1262057	hsa-miR-4727-3p	CLIP-seq
MIRT1262058	hsa-miR-4735-3p	CLIP-seq
MIRT2303754	hsa-miR-4736	CLIP-seq
MIRT2600530	hsa-miR-4738-3p	CLIP-seq
MIRT2600531	hsa-miR-4742-3p	CLIP-seq
MIRT2600532	hsa-miR-4742-5p	CLIP-seq
MIRT2600533	hsa-miR-4755-3p	CLIP-seq
MIRT1262059	hsa-miR-4761-5p	CLIP-seq
MIRT2600534	hsa-miR-4773	CLIP-seq
MIRT2600535	hsa-miR-4790-3p	CLIP-seq
MIRT1262060	hsa-miR-486-3p	CLIP-seq
MIRT1262061	hsa-miR-490-3p	CLIP-seq
MIRT2600536	hsa-miR-498	CLIP-seq
MIRT2600537	hsa-miR-539	CLIP-seq
MIRT1262062	hsa-miR-544b	CLIP-seq
MIRT2600538	hsa-miR-548ac	CLIP-seq
MIRT2600539	hsa-miR-548ae	CLIP-seq
MIRT2600540	hsa-miR-548aj	CLIP-seq
MIRT2600541	hsa-miR-548am	CLIP-seq
MIRT2600542	hsa-miR-548d-3p	CLIP-seq
MIRT2600543	hsa-miR-548x	CLIP-seq
MIRT2600544	hsa-miR-548z	CLIP-seq
MIRT2465915	hsa-miR-558	CLIP-seq
MIRT2600545	hsa-miR-574-5p	CLIP-seq
MIRT2600546	hsa-miR-575	CLIP-seq
MIRT2600547	hsa-miR-582-3p	CLIP-seq
MIRT2600548	hsa-miR-587	CLIP-seq
MIRT2600549	hsa-miR-589	CLIP-seq
MIRT2600550	hsa-miR-626	CLIP-seq
MIRT2600551	hsa-miR-635	CLIP-seq
MIRT1262063	hsa-miR-642a	CLIP-seq
MIRT2077216	hsa-miR-653	CLIP-seq
MIRT2600552	hsa-miR-657	CLIP-seq
MIRT2600553	hsa-miR-661	CLIP-seq
MIRT2465916	hsa-miR-708	CLIP-seq
MIRT2600554	hsa-miR-761	CLIP-seq
MIRT1262064	hsa-miR-9	CLIP-seq
MIRT2600457	hsa-miR-103b	CLIP-seq
MIRT2600458	hsa-miR-1185	CLIP-seq
MIRT1262041	hsa-miR-1200	CLIP-seq
MIRT2600459	hsa-miR-1202	CLIP-seq
MIRT2465909	hsa-miR-1205	CLIP-seq
MIRT1262042	hsa-miR-1225-5p	CLIP-seq
MIRT2600460	hsa-miR-1227	CLIP-seq
MIRT2600462	hsa-miR-1252	CLIP-seq
MIRT2600463	hsa-miR-1254	CLIP-seq
MIRT2077207	hsa-miR-1267	CLIP-seq
MIRT2600464	hsa-miR-1269	CLIP-seq
MIRT2600465	hsa-miR-1269b	CLIP-seq
MIRT2600466	hsa-miR-1273	CLIP-seq
MIRT2465910	hsa-miR-1286	CLIP-seq
MIRT1262043	hsa-miR-133a	CLIP-seq
MIRT1262044	hsa-miR-133b	CLIP-seq
MIRT2077208	hsa-miR-141	CLIP-seq
MIRT2600467	hsa-miR-142-5p	CLIP-seq
MIRT2600470	hsa-miR-181a	CLIP-seq
MIRT2600471	hsa-miR-181b	CLIP-seq
MIRT2600472	hsa-miR-181c	CLIP-seq
MIRT2600473	hsa-miR-181d	CLIP-seq
MIRT1262045	hsa-miR-186	CLIP-seq
MIRT1262046	hsa-miR-18a	CLIP-seq
MIRT1262047	hsa-miR-18b	CLIP-seq
MIRT2600474	hsa-miR-1910	CLIP-seq
MIRT2600475	hsa-miR-1912	CLIP-seq
MIRT2077209	hsa-miR-200a	CLIP-seq
MIRT2303740	hsa-miR-203	CLIP-seq
MIRT2600477	hsa-miR-214	CLIP-seq
MIRT1262048	hsa-miR-2467-3p	CLIP-seq
MIRT2465911	hsa-miR-28-5p	CLIP-seq
MIRT2600478	hsa-miR-31	CLIP-seq
MIRT2600479	hsa-miR-3116	CLIP-seq
MIRT1262049	hsa-miR-3120-3p	CLIP-seq
MIRT1262050	hsa-miR-3133	CLIP-seq
MIRT2465912	hsa-miR-3139	CLIP-seq
MIRT2600482	hsa-miR-3160-3p	CLIP-seq
MIRT2600483	hsa-miR-3168	CLIP-seq
MIRT2600484	hsa-miR-3176	CLIP-seq
MIRT2303743	hsa-miR-3182	CLIP-seq
MIRT2600485	hsa-miR-3194-3p	CLIP-seq
MIRT2303744	hsa-miR-3194-5p	CLIP-seq
MIRT2465913	hsa-miR-3197	CLIP-seq
MIRT2600486	hsa-miR-320a	CLIP-seq
MIRT2600487	hsa-miR-320b	CLIP-seq
MIRT2600488	hsa-miR-320c	CLIP-seq
MIRT2600489	hsa-miR-320d	CLIP-seq
MIRT2600490	hsa-miR-320e	CLIP-seq
MIRT2600491	hsa-miR-340	CLIP-seq
MIRT2600492	hsa-miR-3605-5p	CLIP-seq
MIRT2600493	hsa-miR-3619-5p	CLIP-seq
MIRT2600494	hsa-miR-3649	CLIP-seq
MIRT2600495	hsa-miR-3652	CLIP-seq
MIRT2600496	hsa-miR-3679-5p	CLIP-seq
MIRT2600497	hsa-miR-3690	CLIP-seq
MIRT1262051	hsa-miR-378g	CLIP-seq
MIRT2600498	hsa-miR-3908	CLIP-seq
MIRT2600499	hsa-miR-3922-3p	CLIP-seq
MIRT2600501	hsa-miR-3942-3p	CLIP-seq
MIRT2600502	hsa-miR-3972	CLIP-seq
MIRT2600503	hsa-miR-421	CLIP-seq
MIRT2077211	hsa-miR-4254	CLIP-seq
MIRT1262052	hsa-miR-4257	CLIP-seq
MIRT2600505	hsa-miR-4262	CLIP-seq
MIRT2077212	hsa-miR-4267	CLIP-seq
MIRT2077213	hsa-miR-4292	CLIP-seq
MIRT2077214	hsa-miR-4308	CLIP-seq
MIRT1262053	hsa-miR-431	CLIP-seq
MIRT2600508	hsa-miR-432	CLIP-seq
MIRT1262054	hsa-miR-4324	CLIP-seq
MIRT2600511	hsa-miR-4429	CLIP-seq
MIRT2600512	hsa-miR-4430	CLIP-seq
MIRT2600513	hsa-miR-4434	CLIP-seq
MIRT2303748	hsa-miR-4436b-3p	CLIP-seq
MIRT2600514	hsa-miR-4487	CLIP-seq
MIRT2600515	hsa-miR-4505	CLIP-seq
MIRT2600516	hsa-miR-4516	CLIP-seq
MIRT2600517	hsa-miR-4529-3p	CLIP-seq
MIRT2600518	hsa-miR-4531	CLIP-seq
MIRT2600519	hsa-miR-4532	CLIP-seq
MIRT2077215	hsa-miR-4537	CLIP-seq
MIRT2600520	hsa-miR-455-3p	CLIP-seq
MIRT2600521	hsa-miR-4638-3p	CLIP-seq
MIRT1262055	hsa-miR-4639-5p	CLIP-seq
MIRT2600522	hsa-miR-4650-5p	CLIP-seq
MIRT2600523	hsa-miR-4668-3p	CLIP-seq
MIRT2600524	hsa-miR-4676-5p	CLIP-seq
MIRT2303752	hsa-miR-4685-5p	CLIP-seq
MIRT1262056	hsa-miR-4688	CLIP-seq
MIRT2600525	hsa-miR-4696	CLIP-seq
MIRT2600526	hsa-miR-4709-3p	CLIP-seq
MIRT2600527	hsa-miR-4709-5p	CLIP-seq
MIRT2600528	hsa-miR-4722-3p	CLIP-seq
MIRT2465914	hsa-miR-4722-5p	CLIP-seq
MIRT1262057	hsa-miR-4727-3p	CLIP-seq
MIRT1262058	hsa-miR-4735-3p	CLIP-seq
MIRT2303754	hsa-miR-4736	CLIP-seq
MIRT2600530	hsa-miR-4738-3p	CLIP-seq
MIRT2600531	hsa-miR-4742-3p	CLIP-seq
MIRT2600532	hsa-miR-4742-5p	CLIP-seq
MIRT2600533	hsa-miR-4755-3p	CLIP-seq
MIRT1262059	hsa-miR-4761-5p	CLIP-seq
MIRT2600535	hsa-miR-4790-3p	CLIP-seq
MIRT1262060	hsa-miR-486-3p	CLIP-seq
MIRT1262061	hsa-miR-490-3p	CLIP-seq
MIRT2600536	hsa-miR-498	CLIP-seq
MIRT2600537	hsa-miR-539	CLIP-seq
MIRT1262062	hsa-miR-544b	CLIP-seq
MIRT2600538	hsa-miR-548ac	CLIP-seq
MIRT2600539	hsa-miR-548ae	CLIP-seq
MIRT2600540	hsa-miR-548aj	CLIP-seq
MIRT2600541	hsa-miR-548am	CLIP-seq
MIRT2600542	hsa-miR-548d-3p	CLIP-seq
MIRT2600543	hsa-miR-548x	CLIP-seq
MIRT2600544	hsa-miR-548z	CLIP-seq
MIRT2465915	hsa-miR-558	CLIP-seq
MIRT2600545	hsa-miR-574-5p	CLIP-seq
MIRT2600546	hsa-miR-575	CLIP-seq
MIRT2600547	hsa-miR-582-3p	CLIP-seq
MIRT2600548	hsa-miR-587	CLIP-seq
MIRT2600550	hsa-miR-626	CLIP-seq
MIRT1262063	hsa-miR-642a	CLIP-seq
MIRT2077216	hsa-miR-653	CLIP-seq
MIRT2600552	hsa-miR-657	CLIP-seq
MIRT2600553	hsa-miR-661	CLIP-seq
MIRT2465916	hsa-miR-708	CLIP-seq
MIRT2600554	hsa-miR-761	CLIP-seq
MIRT1262064	hsa-miR-9	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TP53	Unknown	12771025

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16306228, 17028174, 18403135, 18480843, 18624398, 20562859, 21072212, 21988832, 22363791, 23455922, 25686248, 25852190, 28514442, 28561066, 32296183, 32707033, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9693118
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	9575201
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IPI	9693118, 29480465
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0031669	Process	Cellular response to nutrient levels	IDA	30478170
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0031669	Process	Cellular response to nutrient levels	NAS	9693118
GO:0032991	Component	Protein-containing complex	IEA
GO:0035878	Process	Nail development	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27411013

MIM	HGNC	e!Ensembl
602740	9378	ENSG00000111725

Q9Y478

Protein name

5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)

Protein function

Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing p

PDB

4CFE , 4CFF , 4ZHX , 5EZV , 5ISO , 6B1U , 6C9F , 6C9G , 6C9H , 6C9J , 7MYJ , 8BIK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16561	AMPK1_CBM	78 → 161	Glycogen recognition site of AMP-activated protein kinase	Family
PF04739	AMPKBI	199 → 269		Family

Sequence

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Sequence length

270

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (266)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	26491018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21262957, 22021366, 24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28108519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31276230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28202516, 31376944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31441682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28122379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24491542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	40004040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28290498, 29710658, 30308492, 30324705, 30633969, 31584213, 31616396, 31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30668362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28951437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29190959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28290498, 29710658, 30308492, 30324705, 30633969, 31584213, 31616396, 31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	35768580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21459323, 27063143, 27737949, 28178661, 28365690, 29441896, 29480494, 30462530, 30507608, 30637828, 31512724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30100905, 36759597, 37174663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29158183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21459323, 27063143, 27737949, 28178661, 28365690, 29441896, 29480494, 30462530, 30507608, 30637828, 31512724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28412370		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31400930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26804175, 27145268, 28327197, 28374040, 28423712, 28656004, 28696138, 28775788, 28807345, 28856747, 29339542, 29340974, 29513571, 29600521, 30360374 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19372741, 22459208, 23576571, 25975952, 26260992, 30037362, 31060777, 31519809, 32807122, 33477536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	33922358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23396962, 32807122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24792998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27158203, 28453226, 30841449, 34706275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20824095, 28440448, 28498463, 29249655, 29694835, 30415923, 31515527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26068970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21957981, 29979351, 33907836, 39273671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21272562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25491408, 28664915, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	12397075, 23778007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	18594201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	28550180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30459625, 31199069, 31249632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	14519435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30507608, 31607907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	29170419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	29463997		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	30855043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24009772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27602960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30473753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	27085036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29463997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28750357, 30359174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27314881, 28151470, 29491475, 29535833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15896711, 17513605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20220132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27085036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37116137	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24770722, 26892992, 27085036, 27996156, 29500295, 30668361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20808308, 22435535, 24960186, 26116564, 26729093, 28114961, 28258165, 29117108, 29246220, 30875375, 30941959, 33314691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37116137	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct disorder	Pubtator	23778007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29359260, 30519189, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	29170419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20948309, 21957981, 27453294, 30745848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21536015, 29689567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30935928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	18782871	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	31612075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24859760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	22982317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	31729056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29864946, 30031925, 30854676, 31704612, 31815524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12847291, 20797423, 21357378, 22412912, 24135141, 25190626, 27488451, 27611085, 28622524, 29109032, 29689567, 31661292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28376894	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12847291, 20797423, 21357378, 22412912, 24135141, 25190626, 27488451, 27611085, 28622524, 29109032, 29689567, 31661292, 31799531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22459208, 28847510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17878938, 23086037, 24352254, 27902686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31083617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16505254, 17950019, 19245656, 20222801, 21459323, 22349765, 27295301, 27506476, 27743883, 28573460, 28632780, 28706237, 28811612, 28816409, 28956034 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27865838, 29445083, 29778534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30683904, 30876865, 31402399, 31442509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	29025860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28632765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	27951515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31645006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	29137348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26648451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27654259, 33946426, 35635082, 38233384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33331115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Periodic Paralysis	Periodic Paralysis	BEFREE	25348630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21459323, 23823021, 28344322, 28452943, 29092796, 30733434, 31608624, 31697646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29673898, 31108350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30007970, 30522100, 31742890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	29050587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	27444220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28440504, 30678307, 30909789, 31679687, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30678307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28440504, 30678307, 30909789, 31679687, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26488897, 32807122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27001465, 28776671, 31488033, 31542479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33507228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gyrate Atrophy	Gyrate Atrophy	BEFREE	23076989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29069788, 29480501, 31759100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29359260, 30519189, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21572254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
HERMANSKY-PUDLAK SYNDROME 5	Hermansky-Pudlak Syndrome	BEFREE	30977277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28632780, 29509900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28793265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20222801, 28356082, 28743390, 29221790, 29941677, 30811418, 31205529, 31529536, 31581839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30325018, 30811418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26908215, 27762456, 31120956, 31226525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	24286368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28213467, 29659128, 30664704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	31736784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31488323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31736784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15640157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18953439, 23819460, 33472134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30511343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29967351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28285145, 30219731, 30848530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26114600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	14532170, 17878938, 21130749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29444469, 30876865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37707956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28860665, 31661633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31147451		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21262957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25537507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	34943872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20668229, 26505133, 27864418, 28118076, 30082823, 30134922, 31325181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31336728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21274505, 25131770, 25326336, 26089158, 26707164, 26894973, 27602492, 27644987, 28676953, 29152112, 29449537, 29627320, 30009356, 30311444, 30475643 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29449537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28689811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28689811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26089158, 29627320, 30717766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22673193, 34209768, 35778432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30415923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29755474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30388519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23396962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26804175, 27145268, 28327197, 28374040, 28423712, 28656004, 28696138, 28775788, 28807345, 28856747, 29339542, 29340974, 29513571, 29600521, 30360374 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26648451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27731378, 29592879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29234282, 30923462, 31799198, 31840883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20824095, 28440448, 28498463, 29249655, 29694835, 30415923, 31515527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31336728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25491408, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17651733, 21357378, 25493642, 30355942, 30356139, 30997723, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21572254, 26359363, 26499184, 26734992, 29156794, 29228678, 29572236, 30041429, 30453068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24681952, 25756516, 29635244, 30054562, 30405404, 30896863, 31330497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28948276, 29069736, 30053908, 31250978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18466113, 20222801, 21245141, 21572254, 22021366, 23291663, 23370395, 24770722, 24829520, 24994714, 25871473, 26359363, 26707164, 27716618, 27731378 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29400636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21393859, 27314881, 28151470, 29491475, 29535833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19717424, 29532562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	30920150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19187764, 19249673, 22588166, 29027991, 29655680, 30651927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	25190626		★★★★★ ★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	Myoclonic epilepsy with ragged red fibers	Pubtator	22001850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	30013450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	12847291, 21459323, 22016761, 22869320, 28622524, 29064586, 29673898, 29738801, 29942003, 30104247, 30277819, 30968342, 31071567, 31144451, 31817196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22378745, 24352254, 28302767, 34608126, 37488757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28847510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19245656, 20222801, 25779083, 27048379, 31164725, 31241065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	23778007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26491018, 33804447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	30841577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17669398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30419344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30463013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	18397876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29725013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31682805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25936391, 29325933, 30697273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21536015, 29689567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	28067669		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29982462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30557400, 30700698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35545406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27661114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18466113, 18594201, 20222801, 21911917, 23274086, 23291663, 23921130, 24236567, 24694946, 25629604, 26001218, 26359363, 26717043, 27145268, 27239088 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	BEFREE	27534996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24269733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37488757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28811634, 30277819, 30853597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27762456, 28566408, 29673898, 29713145, 29964102, 30060948, 30235452, 30291215, 30544824, 30675881, 31115630, 31195981, 31239155, 31421115, 31445019 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25629933, 28538732, 29990847, 30415923, 31232177, 31293647, 31562701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12847291, 20444420, 24484739, 25123125, 25479240, 25626736, 25779083, 26035386, 26368128, 26817629, 27128935, 28264489, 28445161, 28622524, 28811612 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17878938, 18782871, 21130749, 33922358, 37199333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	29137348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30516280, 30537740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21400477	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29929979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28810524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30013450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28063979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31322006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25491408, 30591219, 31091257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22897928, 26068970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24602453	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29635803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21357378, 25493642, 30355942, 30356139, 30997723, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23159620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27669292, 30997723, 33000197, 35915609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29151954, 30575918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28840510, 29100525, 30112966		★★★★★ ★☆☆☆☆ Found in Text Mining only
periodic paralysis (finding)	Periodic Paralysis	BEFREE	25348630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	29907081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	30860580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29675630, 31816397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29958542, 31722718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	36139470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21262957, 22021366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21968881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	26115946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26359363, 26499184, 26734992, 29156794, 29228678, 29572236, 30041429, 30453068, 31395901, 31597941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20019839, 20570728, 21098087, 24129850, 30987073, 31151054, 37958994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25003216	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30511343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35129068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28364627, 30890932, 31049028, 31302203, 31611754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20948309, 21957981, 27453294, 30745848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30290168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29947538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32807122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39511635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27939519, 28647359, 28974562, 29866515, 30223098, 30797785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31322006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	29725013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30015975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23029387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18953439, 28257034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31191828, 31620247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21459323, 23823021, 23948064, 24486702, 25957914, 28344322, 28452943, 28821440, 29092796, 29126901, 29158183, 30733434, 30972177, 31608624, 31697646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24681952, 25756516, 29635244, 30054562, 30405404, 30896863, 31330497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	29662080	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	36232980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28825325, 30067508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	30718913		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28544264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30219731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28243204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29147952, 29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29546654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30069928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26236947, 33650675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27145268, 29094413, 30152053, 30791936, 31004703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20668229, 24599401, 28561066		★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	24599401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32174982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23301094, 23819460	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30205395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28919424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	28719670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolff-Parkinson-White Syndrome	Wolff-Parkinson-White Syndrome	BEFREE	14519435		★★★★★ ★☆☆☆☆ Found in Text Mining only

PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1)