PRDM7 (PR/SET domain 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 11105
• Gene name: PR/SET domain 7
• Gene symbol: PRDM7
• Synonyms (NCBI Gene): PFM4, ZNF910
• Chromosome: 16
• Chromosome location: 16q24.3
• Summary: This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and

miRNA Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1260350	hsa-miR-183	CLIP-seq
MIRT1260351	hsa-miR-2467-3p	CLIP-seq
MIRT1260352	hsa-miR-3150b-3p	CLIP-seq
MIRT1260353	hsa-miR-3176	CLIP-seq
MIRT1260354	hsa-miR-3922-3p	CLIP-seq
MIRT1260355	hsa-miR-4320	CLIP-seq
MIRT1260356	hsa-miR-4773	CLIP-seq
MIRT1260357	hsa-miR-4784	CLIP-seq
MIRT1260358	hsa-miR-511	CLIP-seq
MIRT1260359	hsa-miR-513b	CLIP-seq
MIRT1260360	hsa-miR-615-5p	CLIP-seq
MIRT1260361	hsa-miR-885-3p	CLIP-seq
MIRT1260362	hsa-miR-922	CLIP-seq
MIRT2076661	hsa-miR-204	CLIP-seq
MIRT2076662	hsa-miR-211	CLIP-seq
MIRT2076663	hsa-miR-3170	CLIP-seq
MIRT2076664	hsa-miR-342-3p	CLIP-seq
MIRT2076665	hsa-miR-377	CLIP-seq
MIRT2076666	hsa-miR-4314	CLIP-seq
MIRT2076667	hsa-miR-4421	CLIP-seq
MIRT2076668	hsa-miR-4452	CLIP-seq
MIRT2076669	hsa-miR-4477b	CLIP-seq
MIRT2076670	hsa-miR-451b	CLIP-seq
MIRT2076671	hsa-miR-4665-3p	CLIP-seq
MIRT2076672	hsa-miR-4667-5p	CLIP-seq
MIRT2076673	hsa-miR-4696	CLIP-seq
MIRT2076674	hsa-miR-4700-5p	CLIP-seq
MIRT2076675	hsa-miR-4711-5p	CLIP-seq
MIRT1260358	hsa-miR-511	CLIP-seq
MIRT2076676	hsa-miR-545	CLIP-seq
MIRT2076677	hsa-miR-554	CLIP-seq
MIRT2076678	hsa-miR-637	CLIP-seq
MIRT2076679	hsa-miR-654-3p	CLIP-seq
MIRT2076680	hsa-miR-665	CLIP-seq
MIRT2076666	hsa-miR-4314	CLIP-seq
MIRT2076672	hsa-miR-4667-5p	CLIP-seq
MIRT2076674	hsa-miR-4700-5p	CLIP-seq
MIRT2076678	hsa-miR-637	CLIP-seq
MIRT2457115	hsa-miR-1182	CLIP-seq
MIRT2457116	hsa-miR-1236	CLIP-seq
MIRT2457117	hsa-miR-1257	CLIP-seq
MIRT2457118	hsa-miR-3120-5p	CLIP-seq
MIRT1260352	hsa-miR-3150b-3p	CLIP-seq
MIRT2457119	hsa-miR-3169	CLIP-seq
MIRT2457120	hsa-miR-3909	CLIP-seq
MIRT2457121	hsa-miR-4299	CLIP-seq
MIRT2457122	hsa-miR-4330	CLIP-seq
MIRT2457123	hsa-miR-4456	CLIP-seq
MIRT2457124	hsa-miR-4689	CLIP-seq
MIRT2457125	hsa-miR-4768-5p	CLIP-seq
MIRT1260357	hsa-miR-4784	CLIP-seq
MIRT2457126	hsa-miR-548q	CLIP-seq
MIRT2457127	hsa-miR-593	CLIP-seq
MIRT2457128	hsa-miR-759	CLIP-seq
MIRT2457129	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0042800	Function	Histone H3K4 methyltransferase activity	IDA	27129774
GO:0042800	Function	Histone H3K4 methyltransferase activity	IEA

Other IDs

• MIM: 609759
• HGNC: 9351
• e!Ensembl: ENSG00000126856

Protein

• UniProt ID: Q9NQW5
• Protein name: Histone-lysine N-methyltransferase PRDM7 (EC 2.1.1.-) (PR domain zinc finger protein 7) (PR domain-containing protein 7) ([histone H3]-lysine4 N-methyltransferase PRDM7)
• Protein function: Histone methyltransferase that selectively methylates 'Lys-4' of dimethylated histone H3 (H3K4me2) to produce trimethylated 'Lys-4' histone H3 (H3K4me3). May play a role in epigenetic regulation of gene expression by defining an active chromatin
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	27 → 65	KRAB box	Family
  PF09514	SSXRD	171 → 201	SSXRD motif	Motif

• Sequence:

  MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNA
  LITVGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMP
  KASFNNESSLRELSGTPNLLNTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKM
  YSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
  SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRN
  CYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWSGDE
  YGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHV
  PHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTK
  PKVKRSKKGPNS

• Sequence length: 492

Pathways

KEGG Pathway	Reactome Pathway
Lysine degradation	Generic Transcription Pathway
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Depressive Disorder	Major depressive disorder	Pubtator	34341332	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PRDM7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRDM7.