PRAP1 (proline rich acidic protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 118471
• Gene name: Proline rich acidic protein 1
• Gene symbol: PRAP1
• Synonyms (NCBI Gene): PRO1195, UPA
• Chromosome: 10
• Chromosome location: 10q26.3

miRNA Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004414	hsa-miR-193b-3p	Western blot, Luciferase reporter assay	19701247
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay	21779487
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT004414	hsa-miR-193b-3p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT006395	hsa-miR-181a-5p	Luciferase reporter assay	21779487
MIRT001177	hsa-miR-23b-3p	Reporter assay;Western blot;qRT-PCR	19490101
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay, Western blot	24330766
MIRT006394	hsa-miR-193a-3p	Luciferase reporter assay, Western blot	24330766
MIRT731181	hsa-miR-181c-5p	qRT-PCR, ELISA, Luciferase reporter assay, Western blot	25554417
MIRT731181	hsa-miR-181c-5p	qRT-PCR, ELISA, Luciferase reporter assay, Western blot	25554417
MIRT1259669	hsa-miR-1299	CLIP-seq
MIRT1259670	hsa-miR-197	CLIP-seq
MIRT1259671	hsa-miR-3663-5p	CLIP-seq
MIRT1259672	hsa-miR-411	CLIP-seq
MIRT1259673	hsa-miR-4423-5p	CLIP-seq
MIRT1259674	hsa-miR-4527	CLIP-seq
MIRT1259675	hsa-miR-4716-5p	CLIP-seq
MIRT1259676	hsa-miR-483-5p	CLIP-seq
MIRT1259677	hsa-miR-5096	CLIP-seq
MIRT1259678	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24374861, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006974	Process	DNA damage response	IDA	23235459
GO:0008289	Function	Lipid binding	IEA
GO:0017129	Function	Triglyceride binding	ISS
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	23235459
GO:0043066	Process	Negative regulation of apoptotic process	IMP	23235459
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0071481	Process	Cellular response to X-ray	ISS
GO:1902426	Process	Deactivation of mitotic spindle assembly checkpoint	IDA	24374861
GO:1904731	Process	Positive regulation of intestinal lipid absorption	ISS
GO:1905885	Process	Positive regulation of triglyceride transport	ISS
GO:2001140	Process	Positive regulation of phospholipid transport	ISS

Other IDs

• MIM: 609776
• HGNC: 23304
• e!Ensembl: ENSG00000165828

Protein

• UniProt ID: Q96NZ9
• Protein name: Proline-rich acidic protein 1 (Epididymis tissue protein Li 178) (Uterine-specific proline-rich acidic protein)
• Protein function: Lipid-binding protein which promotes lipid absorption by facilitating MTTP-mediated lipid transfer (mainly triglycerides and phospholipids) and MTTP-mediated apoB lipoprotein assembly and secretion (By similarity). Protects the gastrointestinal
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15314	PRAP	105 → 149	Proline-rich acidic protein 1, pregnancy-specific uterine	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the intestinal epithelial cells (at protein level) (PubMed:32629119). Abundantly expressed in the epithelial cells of the liver, kidney and cervix. Significantly down-regulated in hepatocellular carcinoma and right
• Sequence:

  MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLV
  VLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEED
  QGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

• Sequence length: 151

Pathways

KEGG Pathway:

Autophagy - animal

Related Genes

No strongly related genes found yet for PRAP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRAP1.