Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	645414
Gene name	PRAME family member 19
Gene symbol	PRAMEF19
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p36.21

26 Show/Hide all (26)

miRTarBase ID	miRNA	Experiments
MIRT1259621	hsa-miR-1254	CLIP-seq
MIRT1259622	hsa-miR-204	CLIP-seq
MIRT1259623	hsa-miR-211	CLIP-seq
MIRT1259624	hsa-miR-3116	CLIP-seq
MIRT1259625	hsa-miR-3672	CLIP-seq
MIRT1259626	hsa-miR-3690	CLIP-seq
MIRT1259627	hsa-miR-369-3p	CLIP-seq
MIRT1259628	hsa-miR-374a	CLIP-seq
MIRT1259629	hsa-miR-374b	CLIP-seq
MIRT1259630	hsa-miR-374c	CLIP-seq
MIRT1259631	hsa-miR-4287	CLIP-seq
MIRT1259632	hsa-miR-4638-3p	CLIP-seq
MIRT1259633	hsa-miR-4685-3p	CLIP-seq
MIRT1259634	hsa-miR-4786-5p	CLIP-seq
MIRT1259635	hsa-miR-655	CLIP-seq
MIRT1259636	hsa-miR-769-5p	CLIP-seq
MIRT1259621	hsa-miR-1254	CLIP-seq
MIRT1259624	hsa-miR-3116	CLIP-seq
MIRT1259626	hsa-miR-3690	CLIP-seq
MIRT1259632	hsa-miR-4638-3p	CLIP-seq
MIRT1259634	hsa-miR-4786-5p	CLIP-seq
MIRT1259636	hsa-miR-769-5p	CLIP-seq
MIRT2599830	hsa-miR-4760-3p	CLIP-seq
MIRT2599831	hsa-miR-873	CLIP-seq
MIRT2599830	hsa-miR-4760-3p	CLIP-seq
MIRT2599831	hsa-miR-873	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IBA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5SWL8

Protein name

PRAME family member 19

Family and domains

Sequence

MSFQAPRRLLELAGQSLLRDQALAISVLDELPRELFPRLFVEAFTSRCCEVLKVMVQAWP
FPCLPLGSLMKTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLEMRDVDENFWTIWSGAR
PLSCSPEAMSKRQTVEDCPRTGEKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHL
CCTKVVNYSMNILNFRNILETVYPDSIQVLEIWNMCWPCMVAEVSRYLSQMKNLRKLFIS
DGCGYLPSFESQGQLVAEFSSVFLRLEYLQMLYMRRIRFFEGYLDQLIRCLKSPLETLAL
TYGSLDEEDLKCLPWYPSLSQLKQLNLSHGTLRFIRLEPLRALLEKVAATLQTLFLVDCG
IGDSKLRVILPALSRCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRESLD
NRGRVISELLTPLQAELMRILREVREPNRIFFGPVSCPCCGMSPTEQLEFNFCLRGRPA

Sequence length

479

Interactions

View interactions

Related Genes Genes most often co-reported with PRAMEF19 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PRAMEF19.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PRAMEF19 (see Related Genes above), that are NOT already directly curated for PRAMEF19 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PRAMEF19.

PRAMEF19 (PRAME family member 19)

Save This Analysis