Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	400736
Gene name	PRAME family member 13
Gene symbol	PRAMEF13
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p36.21

30 Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019179	hsa-miR-335-5p	Microarray	18185580
MIRT051701	hsa-let-7e-5p	CLASH	23622248
MIRT1259573	hsa-miR-3673	CLIP-seq
MIRT1259574	hsa-miR-370	CLIP-seq
MIRT1259575	hsa-miR-4282	CLIP-seq
MIRT1259576	hsa-miR-4307	CLIP-seq
MIRT1259577	hsa-miR-4446-5p	CLIP-seq
MIRT1259578	hsa-miR-4476	CLIP-seq
MIRT1259579	hsa-miR-4477a	CLIP-seq
MIRT1259580	hsa-miR-4649-3p	CLIP-seq
MIRT1259581	hsa-miR-4755-5p	CLIP-seq
MIRT1259582	hsa-miR-548c-3p	CLIP-seq
MIRT1259583	hsa-miR-642a	CLIP-seq
MIRT1259584	hsa-miR-651	CLIP-seq
MIRT1259585	hsa-miR-944	CLIP-seq
MIRT2076506	hsa-miR-3145-3p	CLIP-seq
MIRT2303135	hsa-miR-139-5p	CLIP-seq
MIRT2303136	hsa-miR-1827	CLIP-seq
MIRT1259578	hsa-miR-4476	CLIP-seq
MIRT1259580	hsa-miR-4649-3p	CLIP-seq
MIRT2303137	hsa-miR-4705	CLIP-seq
MIRT2303138	hsa-miR-4722-5p	CLIP-seq
MIRT2303139	hsa-miR-4738-3p	CLIP-seq
MIRT1259584	hsa-miR-651	CLIP-seq
MIRT2303140	hsa-miR-940	CLIP-seq
MIRT1259573	hsa-miR-3673	CLIP-seq
MIRT1259575	hsa-miR-4282	CLIP-seq
MIRT1259579	hsa-miR-4477a	CLIP-seq
MIRT1259582	hsa-miR-548c-3p	CLIP-seq
MIRT1259585	hsa-miR-944	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IBA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5VWM6

Protein name

PRAME family member 13

Family and domains

Sequence

MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFRRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRRKLQVLDLRDVDENFWARWPGAW
ALSCFPETMSKRQTAEDRPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKHLRKSLKIIYLNSIQELEIHNMSWPRLIRKLRCYLKEMKTLGKLVFS
RCHHSTSDNELEGRLVTKFSSVFLGLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDVKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLETLILEGCQ
IHYSQLSAILPGLSRCSQLTTFYFGRNCMSMGALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVNWEIFTPLRAELMCTLREVRQPKRIFIGPTPCPSCGSSLSEELELHLCC

Sequence length

474

Interactions

View interactions

Related Genes Genes most often co-reported with PRAMEF13 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PRAMEF13.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PRAMEF13 (see Related Genes above), that are NOT already directly curated for PRAMEF13 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PRAMEF13.

PRAMEF13 (PRAME family member 13)

Save This Analysis