PRADC1 (protease associated domain containing 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 84279
• Gene name: Protease associated domain containing 1
• Gene symbol: PRADC1
• Synonyms (NCBI Gene): C2orf7, PAP21
• Chromosome: 2
• Chromosome location: 2p13.2

miRNA Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024561	hsa-miR-215-5p	Microarray	19074876
MIRT026624	hsa-miR-192-5p	Microarray	19074876
MIRT042012	hsa-miR-484	CLASH	23622248
MIRT1259525	hsa-miR-2110	CLIP-seq
MIRT1259526	hsa-miR-3202	CLIP-seq
MIRT1259527	hsa-miR-4271	CLIP-seq
MIRT1259528	hsa-miR-4292	CLIP-seq
MIRT1259529	hsa-miR-4493	CLIP-seq
MIRT1259530	hsa-miR-4667-5p	CLIP-seq
MIRT1259531	hsa-miR-4700-5p	CLIP-seq
MIRT1259532	hsa-miR-4725-3p	CLIP-seq
MIRT1259533	hsa-miR-4747-5p	CLIP-seq
MIRT1259534	hsa-miR-4753-5p	CLIP-seq
MIRT2076453	hsa-miR-125a-3p	CLIP-seq
MIRT2076454	hsa-miR-1266	CLIP-seq
MIRT2076455	hsa-miR-1972	CLIP-seq
MIRT2076456	hsa-miR-2467-3p	CLIP-seq
MIRT2076457	hsa-miR-3132	CLIP-seq
MIRT2076458	hsa-miR-3135b	CLIP-seq
MIRT2076459	hsa-miR-3652	CLIP-seq
MIRT2076460	hsa-miR-3659	CLIP-seq
MIRT2076461	hsa-miR-3664-3p	CLIP-seq
MIRT2076462	hsa-miR-3678-3p	CLIP-seq
MIRT1259528	hsa-miR-4292	CLIP-seq
MIRT2076463	hsa-miR-4297	CLIP-seq
MIRT2076464	hsa-miR-4430	CLIP-seq
MIRT2076465	hsa-miR-4504	CLIP-seq
MIRT2076466	hsa-miR-4518	CLIP-seq
MIRT2076467	hsa-miR-4650-5p	CLIP-seq
MIRT2076468	hsa-miR-4658	CLIP-seq
MIRT2076469	hsa-miR-4717-5p	CLIP-seq
MIRT2076470	hsa-miR-4725-5p	CLIP-seq
MIRT2076471	hsa-miR-485-5p	CLIP-seq
MIRT2076472	hsa-miR-504	CLIP-seq
MIRT2076473	hsa-miR-542-3p	CLIP-seq
MIRT2076474	hsa-miR-574-5p	CLIP-seq
MIRT2076475	hsa-miR-760	CLIP-seq
MIRT2303115	hsa-miR-1253	CLIP-seq
MIRT2303116	hsa-miR-137	CLIP-seq
MIRT2076460	hsa-miR-3659	CLIP-seq
MIRT2303117	hsa-miR-4276	CLIP-seq
MIRT2303118	hsa-miR-4461	CLIP-seq
MIRT2076465	hsa-miR-4504	CLIP-seq
MIRT2303119	hsa-miR-4639-5p	CLIP-seq
MIRT2076468	hsa-miR-4658	CLIP-seq
MIRT2303120	hsa-miR-4697-3p	CLIP-seq
MIRT2076473	hsa-miR-542-3p	CLIP-seq
MIRT2076474	hsa-miR-574-5p	CLIP-seq
MIRT2303121	hsa-miR-629	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	IDA	15498570
GO:0005576	Component	Extracellular region	IEA

Other IDs

• MIM: 619674
• HGNC: 16047
• e!Ensembl: ENSG00000135617

Protein

• UniProt ID: Q9BSG0
• Protein name: Protease-associated domain-containing protein 1 (Protease-associated domain-containing protein of 21 kDa) (hPAP21)
• Protein function: Plays a role in the modulation of physical activity and adiposity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02225	PA	62 → 152	PA domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in skeletal muscle, heart and liver. Expressed at intermediate level in kidney. {ECO:0000269|PubMed:15498570}.
• Sequence:

  MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRY
  EQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVD
  NDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFEL
  LQPPWTFW

• Sequence length: 188

Related Genes

No strongly related genes found yet for PRADC1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PRADC1.