PPP4R1L (protein phosphatase 4 regulatory subunit 1 like (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55370
Gene name Protein phosphatase 4 regulatory subunit 1 like (pseudogene)
Gene symbol PPP4R1L
Synonyms (NCBI Gene)
C20orf192PPP4R1P1PRO1085
Chromosome 20
Chromosome location 20q13.32
miRNA miRNA information provided by mirtarbase database.
19 Show/Hide all (19)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018259 hsa-miR-335-5p Microarray 18185580
MIRT446654 hsa-miR-369-3p PAR-CLIP 22291592
MIRT446652 hsa-miR-4539 PAR-CLIP 22291592
MIRT446653 hsa-miR-27b-5p PAR-CLIP 22291592
MIRT446654 hsa-miR-369-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10026142
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 15755 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P1A2
Protein name Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like
Protein function May be a regulatory subunit of serine/threonine-protein phosphatase 4.
Family and domains
Sequence 
MAEIPLYFVDLQDDLDDYGFEDYGTDCDNMRVTAFLDIPGQDNLPPLTRLEKYAFSENTF
NRQIIARGLLDIFRDFGNNEEDFLTVMEIVVRLSEDAEPTVRTELMEQIPPIAIFLQENR
SNFPVVLSEYLIPIVVRYLTDPNNQIICKMASMLSKSTVERLLLPRFCELCGDRKLFQVR
KVCAANFGDICHAVGQEATEKFLIPKFFELCSDAVWGMRKACAECFTAVSHSSSPGVRRT
QLFPLFIRLVSDPCRWVHQAAFQSLGPFTSTFANPSRAGLYLREDGALSIWPLTQDLDSG
FASGSPAPSSGGNTSPASLTRSAKPVRSEPELPVEGTSAKTSDCPHSSSSSDGPAESPVE
SCVSAGAEWTRVSPETSACSKLSDMNDLPISSYPGSDSWACPGNTEDVFSHFLYW
Sequence length 415
Interactions View interactions

No strongly related genes found yet for PPP4R1L.

No additional diseases found yet through genes similar to PPP4R1L.