PPP1R2P1 (protein phosphatase 1 regulatory inhibitor subunit 2 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100507444
Gene name Protein phosphatase 1 regulatory inhibitor subunit 2 pseudogene 1
Gene symbol PPP1R2P1
Synonyms (NCBI Gene)
IPP-2PPPP1R2P
Chromosome 6
Chromosome location 6p21.32
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IBA
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0005977 Process Glycogen metabolic process IEA
GO:0009966 Process Regulation of signal transduction IEA
GO:0035556 Process Intracellular signal transduction IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 9289 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96PQ5
Protein name Putative protein phosphatase inhibitor 2-like protein 1 (Protein phosphatase 1, regulatory subunit 2 pseudogene 1)
Protein function Inhibitor of protein-phosphatase 1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04979 IPP-2 45 → 173 Protein phosphatase inhibitor 2 (IPP-2) Family
Sequence 
MAASTASQRPLKGILKDNTSTTSSMVASAEHPRGSVHEQLSKKSQKWDEMNILATYRPAD
KDYGLMKIDEPSTPYHSTMGDDEDACSDTETTEAMATDSLAKNLAAAEGLEPKYQVQEQE
SSGEEDSDLSPEEREKKRQFEMRRTLHYNEGLNIKLARQLISKDLHDDDKVEEMLETAHG
ESMNTEESNQGSTASDQQQNKSRSS
Sequence length 205
Interactions View interactions

No strongly related genes found yet for PPP1R2P1.

No additional diseases found yet through genes similar to PPP1R2P1.