PPP1R2C (PPP1R2 family member C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80316
Gene name PPP1R2 family member C
Gene symbol PPP1R2C
Synonyms (NCBI Gene)
I-4PPP1R2P9
Chromosome X
Chromosome location Xp11.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IBA
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0004864 Function Protein phosphatase inhibitor activity NAS 11076525
GO:0005515 Function Protein binding IPI 32296183
GO:0009966 Process Regulation of signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301017 16324 ENSG00000102055
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14990
Protein name Protein phosphatase inhibitor 2 family member C (PPP1R2 family member B) (Protein phosphatase 1, regulatory subunit 2 pseudogene 9) (Type-1 protein phosphatase inhibitor 4) (I-4)
Protein function Functions as a protein phosphatase inhibitor. It inhibits activity of the catalytic subunit of PP1 and weakly inhibits the activity of myosin-associated phosphates.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04979 IPP-2 45 → 172 Protein phosphatase inhibitor 2 (IPP-2) Family
Tissue specificity TISSUE SPECIFICITY: Detected in sperm (at protein level). {ECO:0000269|PubMed:24195737}.
Sequence 
MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATY
RDYDLMKANEPGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSE
AYMRKILLHKQEKKRQFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEK
TAAEESEEAPLTGGLQTQSCDP
Sequence length 202
Interactions View interactions

No strongly related genes found yet for PPP1R2C.

No additional diseases found yet through genes similar to PPP1R2C.