PPP1R2B (PPP1R2 family member B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 153743
Gene name PPP1R2 family member B
Gene symbol PPP1R2B
Synonyms (NCBI Gene)
PPP1R2P3
Chromosome 5
Chromosome location 5q33.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004864 Function Protein phosphatase inhibitor activity IBA
GO:0004864 Function Protein phosphatase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005977 Process Glycogen metabolic process IEA
GO:0009966 Process Regulation of signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NXS1
Protein name Protein phosphatase inhibitor 2 family member B (PPP1R2 family member B) (Protein phosphatase 1, regulatory subunit 2 pseudogene 3) (Protein phosphatase inhibitor 2-like protein 3)
Protein function Inhibitor of protein-phosphatase 1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04979 IPP-2 45 → 173 Protein phosphatase inhibitor 2 (IPP-2) Family
Tissue specificity TISSUE SPECIFICITY: Only detected in spermatozoa, both heads and tails. {ECO:0000269|PubMed:23506001}.
Sequence 
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPAD
KGYGLMKIDEPSPPYHSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLEPKYRIQEQE
SSGEEDSDLSPEEREKKRQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADG
ESMNTEESNQGSTPSDQQQNKLRSS
Sequence length 205
Interactions View interactions

No strongly related genes found yet for PPP1R2B.

No additional diseases found yet through genes similar to PPP1R2B.