Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5502
Gene name	Protein phosphatase 1 regulatory inhibitor subunit 1A
Gene symbol	PPP1R1A
Synonyms (NCBI Gene)	I1IPP1
Chromosome	12
Chromosome location	12q13.2

143

Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018310	hsa-miR-335-5p	Microarray	18185580
MIRT038385	hsa-miR-296-3p	CLASH	23622248
MIRT519160	hsa-miR-4678	HITS-CLIP	21572407
MIRT519159	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT519158	hsa-miR-4469	HITS-CLIP	21572407
MIRT519157	hsa-miR-331-5p	HITS-CLIP	21572407
MIRT519156	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT519155	hsa-miR-6509-5p	HITS-CLIP	21572407
MIRT519154	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT519160	hsa-miR-4678	PAR-CLIP	21572407
MIRT519159	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT552112	hsa-miR-3126-3p	PAR-CLIP	21572407
MIRT552111	hsa-miR-1298-3p	PAR-CLIP	21572407
MIRT552110	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT552109	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT552108	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT552107	hsa-miR-612	PAR-CLIP	21572407
MIRT552106	hsa-miR-6860	PAR-CLIP	21572407
MIRT552104	hsa-miR-4486	PAR-CLIP	21572407
MIRT552105	hsa-miR-378g	PAR-CLIP	21572407
MIRT519157	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT519156	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT552103	hsa-miR-3924	PAR-CLIP	21572407
MIRT519155	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT519154	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT519160	hsa-miR-4678	PAR-CLIP	23446348
MIRT519159	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519158	hsa-miR-4469	PAR-CLIP	23446348
MIRT519157	hsa-miR-331-5p	PAR-CLIP	23446348
MIRT519156	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519155	hsa-miR-6509-5p	PAR-CLIP	23446348
MIRT519154	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT737207	hsa-miR-3922-5p	Luciferase reporter assayqRT-PCR	31797701
MIRT519160	hsa-miR-4678	HITS-CLIP	21572407
MIRT519159	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT519158	hsa-miR-4469	HITS-CLIP	21572407
MIRT519157	hsa-miR-331-5p	HITS-CLIP	21572407
MIRT519156	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT519155	hsa-miR-6509-5p	HITS-CLIP	21572407
MIRT519154	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT519160	hsa-miR-4678	PAR-CLIP	21572407
MIRT519159	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT552112	hsa-miR-3126-3p	PAR-CLIP	21572407
MIRT552111	hsa-miR-1298-3p	PAR-CLIP	21572407
MIRT552110	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT552109	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT552108	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT552107	hsa-miR-612	PAR-CLIP	21572407
MIRT552106	hsa-miR-6860	PAR-CLIP	21572407
MIRT552104	hsa-miR-4486	PAR-CLIP	21572407
MIRT552105	hsa-miR-378g	PAR-CLIP	21572407
MIRT519157	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT519156	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT552103	hsa-miR-3924	PAR-CLIP	21572407
MIRT519155	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT519154	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT519160	hsa-miR-4678	PAR-CLIP	23446348
MIRT519159	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT519158	hsa-miR-4469	PAR-CLIP	23446348
MIRT519157	hsa-miR-331-5p	PAR-CLIP	23446348
MIRT519156	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT519155	hsa-miR-6509-5p	PAR-CLIP	23446348
MIRT519154	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1256308	hsa-miR-106a	CLIP-seq
MIRT1256309	hsa-miR-106b	CLIP-seq
MIRT1256310	hsa-miR-1252	CLIP-seq
MIRT1256311	hsa-miR-1321	CLIP-seq
MIRT1256312	hsa-miR-140-3p	CLIP-seq
MIRT1256313	hsa-miR-145	CLIP-seq
MIRT1256314	hsa-miR-17	CLIP-seq
MIRT1256315	hsa-miR-186	CLIP-seq
MIRT1256316	hsa-miR-20a	CLIP-seq
MIRT1256317	hsa-miR-20b	CLIP-seq
MIRT1256318	hsa-miR-214	CLIP-seq
MIRT1256319	hsa-miR-2861	CLIP-seq
MIRT1256320	hsa-miR-3152-5p	CLIP-seq
MIRT1256321	hsa-miR-3153	CLIP-seq
MIRT1256322	hsa-miR-3194-3p	CLIP-seq
MIRT1256323	hsa-miR-338-3p	CLIP-seq
MIRT1256324	hsa-miR-3619-5p	CLIP-seq
MIRT1256325	hsa-miR-3925-3p	CLIP-seq
MIRT1256326	hsa-miR-3977	CLIP-seq
MIRT1256327	hsa-miR-4270	CLIP-seq
MIRT1256328	hsa-miR-4291	CLIP-seq
MIRT1256329	hsa-miR-4297	CLIP-seq
MIRT1256330	hsa-miR-4441	CLIP-seq
MIRT1256331	hsa-miR-4459	CLIP-seq
MIRT1256332	hsa-miR-4480	CLIP-seq
MIRT1256333	hsa-miR-4530	CLIP-seq
MIRT1256334	hsa-miR-4649-3p	CLIP-seq
MIRT1256335	hsa-miR-4659a-3p	CLIP-seq
MIRT1256336	hsa-miR-4659b-3p	CLIP-seq
MIRT1256337	hsa-miR-4695-5p	CLIP-seq
MIRT1256338	hsa-miR-4716-3p	CLIP-seq
MIRT1256339	hsa-miR-4728-5p	CLIP-seq
MIRT1256340	hsa-miR-4739	CLIP-seq
MIRT1256341	hsa-miR-4753-3p	CLIP-seq
MIRT1256342	hsa-miR-4756-5p	CLIP-seq
MIRT1256343	hsa-miR-4757-5p	CLIP-seq
MIRT1256344	hsa-miR-519d	CLIP-seq
MIRT1256345	hsa-miR-625	CLIP-seq
MIRT1256346	hsa-miR-665	CLIP-seq
MIRT1256347	hsa-miR-760	CLIP-seq
MIRT1256348	hsa-miR-761	CLIP-seq
MIRT1256349	hsa-miR-765	CLIP-seq
MIRT1256350	hsa-miR-766	CLIP-seq
MIRT1256351	hsa-miR-767-3p	CLIP-seq
MIRT1256352	hsa-miR-922	CLIP-seq
MIRT1256353	hsa-miR-93	CLIP-seq
MIRT1256354	hsa-miR-942	CLIP-seq
MIRT1556829	hsa-miR-15a	CLIP-seq
MIRT1556830	hsa-miR-15b	CLIP-seq
MIRT1556831	hsa-miR-16	CLIP-seq
MIRT1556832	hsa-miR-195	CLIP-seq
MIRT1256318	hsa-miR-214	CLIP-seq
MIRT1556833	hsa-miR-3613-3p	CLIP-seq
MIRT1256324	hsa-miR-3619-5p	CLIP-seq
MIRT1556834	hsa-miR-424	CLIP-seq
MIRT1556835	hsa-miR-4722-5p	CLIP-seq
MIRT1556836	hsa-miR-4768-3p	CLIP-seq
MIRT1556837	hsa-miR-497	CLIP-seq
MIRT1256348	hsa-miR-761	CLIP-seq
MIRT2075494	hsa-miR-1207-3p	CLIP-seq
MIRT2075495	hsa-miR-1207-5p	CLIP-seq
MIRT1256313	hsa-miR-145	CLIP-seq
MIRT2075496	hsa-miR-1827	CLIP-seq
MIRT1256323	hsa-miR-338-3p	CLIP-seq
MIRT2075497	hsa-miR-3714	CLIP-seq
MIRT1256325	hsa-miR-3925-3p	CLIP-seq
MIRT1256327	hsa-miR-4270	CLIP-seq
MIRT2075498	hsa-miR-4436b-3p	CLIP-seq
MIRT1256330	hsa-miR-4441	CLIP-seq
MIRT2075499	hsa-miR-4453	CLIP-seq
MIRT1256331	hsa-miR-4459	CLIP-seq
MIRT1256333	hsa-miR-4530	CLIP-seq
MIRT2075500	hsa-miR-4538	CLIP-seq
MIRT2075501	hsa-miR-4763-3p	CLIP-seq
MIRT1256350	hsa-miR-766	CLIP-seq
MIRT2302160	hsa-miR-3124-3p	CLIP-seq
MIRT1256323	hsa-miR-338-3p	CLIP-seq
MIRT1256333	hsa-miR-4530	CLIP-seq
MIRT1256335	hsa-miR-4659a-3p	CLIP-seq
MIRT1256336	hsa-miR-4659b-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004865	Function	Protein serine/threonine phosphatase inhibitor activity	TAS	8611507
GO:0005515	Function	Protein binding	IPI	11564868, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IBA

MIM	HGNC	e!Ensembl
613246	9286	ENSG00000135447

Q13522

Protein name

Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)

Protein function

Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05395	DARPP-32	3 → 166	Protein phosphatase inhibitor 1/DARPP-32	Family

Sequence

MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHL
KSTLAMSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTETQESRPPGIPD
TEVESRLGTSGTAKKTAECIPKTHERGSKEPSTKEPSTHIPPLDSKGANSV

Sequence length

171

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARRHYTHMIAS, CARDIAC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low-frequency hearing loss	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low-frequency sensorineural hearing impairment	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rosette-forming glioneuronal tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28978030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11836553, 31070915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	14595753		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	14968122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29067128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	21354993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28758430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31822434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29073215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20888416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28758430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23320987, 25060643, 28145580, 31797701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28246607, 29246957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32883362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30182276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	28978030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	20071777		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	20071777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29250654		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29724292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29724292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30579250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24885636, 31070915, 31545548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37596405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	14732205, 18698139, 21354993, 23271792, 25023328, 26455482, 28958332, 29350681, 29710499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20071777		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	22971085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	28246607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28128866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29185012, 32705173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	12890806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29059150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29601129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12507886, 24496381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12507886, 24496381, 26111795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24030211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	14732205, 18698139, 21354993, 23271792, 25023328, 26455482, 28958332, 29350681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	18192322, 18698139	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	20071777		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20071777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	14595753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30802452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20071777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24220271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	15010824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10494025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24030211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23320987, 25060643, 28145580, 31797701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28246607, 29246957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30182276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29299930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21276850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26134677, 28987382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12032660, 20875083, 21436583, 23320987, 28978030, 29307615, 29476043, 30210930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29724292		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24924589, 30131853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16224484, 30455393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	16224484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27586591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	20071777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20071777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23271792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10455913, 27542250, 28479381, 29059150, 30186285, 30485073, 30850682, 31070915, 31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30182276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29299930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28790323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29851077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	15302515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21276850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25467295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30008914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	14968122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	27287430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18474628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	20538790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26134677, 28987382		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	9454902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	30409962		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP1R1A (protein phosphatase 1 regulatory inhibitor subunit 1A)