PPP1R15A (protein phosphatase 1 regulatory subunit 15A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23645
• Gene name: Protein phosphatase 1 regulatory subunit 15A
• Gene symbol: PPP1R15A
• Synonyms (NCBI Gene): GADD34
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless o

miRNA Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050807	hsa-miR-17-5p	CLASH	23622248
MIRT650889	hsa-miR-148b-5p	HITS-CLIP	23824327
MIRT650888	hsa-miR-6874-3p	HITS-CLIP	23824327
MIRT650886	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT650885	hsa-miR-4251	HITS-CLIP	23824327
MIRT650884	hsa-miR-4329	HITS-CLIP	23824327
MIRT650883	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT650882	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT650873	hsa-miR-4303	HITS-CLIP	23824327
MIRT650872	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT650890	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT650889	hsa-miR-148b-5p	HITS-CLIP	23824327
MIRT650888	hsa-miR-6874-3p	HITS-CLIP	23824327
MIRT650887	hsa-miR-4277	HITS-CLIP	23824327
MIRT650886	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT650885	hsa-miR-4251	HITS-CLIP	23824327
MIRT650884	hsa-miR-4329	HITS-CLIP	23824327
MIRT650883	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT650882	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT650881	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT650880	hsa-miR-363-5p	HITS-CLIP	23824327
MIRT650879	hsa-miR-6745	HITS-CLIP	23824327
MIRT650878	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT650877	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT650876	hsa-miR-1293	HITS-CLIP	23824327
MIRT650875	hsa-miR-4483	HITS-CLIP	23824327
MIRT650874	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT650873	hsa-miR-4303	HITS-CLIP	23824327
MIRT650872	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT650889	hsa-miR-148b-5p	HITS-CLIP	23824327
MIRT650888	hsa-miR-6874-3p	HITS-CLIP	23824327
MIRT650886	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT650885	hsa-miR-4251	HITS-CLIP	23824327
MIRT650884	hsa-miR-4329	HITS-CLIP	23824327
MIRT650883	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT650882	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT650873	hsa-miR-4303	HITS-CLIP	23824327
MIRT650872	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT650890	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT650889	hsa-miR-148b-5p	HITS-CLIP	23824327
MIRT650888	hsa-miR-6874-3p	HITS-CLIP	23824327
MIRT650887	hsa-miR-4277	HITS-CLIP	23824327
MIRT650886	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT650885	hsa-miR-4251	HITS-CLIP	23824327
MIRT650884	hsa-miR-4329	HITS-CLIP	23824327
MIRT650883	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT650882	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT650881	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT650880	hsa-miR-363-5p	HITS-CLIP	23824327
MIRT650879	hsa-miR-6745	HITS-CLIP	23824327
MIRT650878	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT650877	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT650876	hsa-miR-1293	HITS-CLIP	23824327
MIRT650875	hsa-miR-4483	HITS-CLIP	23824327
MIRT650874	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT650873	hsa-miR-4303	HITS-CLIP	23824327
MIRT650872	hsa-miR-3180-5p	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000164	Component	Protein phosphatase type 1 complex	IBA
GO:0000164	Component	Protein phosphatase type 1 complex	IDA	11564868, 12556489
GO:0000164	Component	Protein phosphatase type 1 complex	IPI	34847777
GO:0005515	Function	Protein binding	IPI	11564868, 15231748, 21988832, 26095357, 29109149
GO:0005737	Component	Cytoplasm	IDA	21518769
GO:0005739	Component	Mitochondrion	IDA	21518769
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	12556489, 21518769
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	21518769
GO:0005794	Component	Golgi apparatus	IDA	21518769
GO:0005829	Component	Cytosol	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IDA	11564868
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9153226
GO:0006974	Process	DNA damage response	TAS	9153226
GO:0008157	Function	Protein phosphatase 1 binding	IDA	11564868
GO:0008157	Function	Protein phosphatase 1 binding	IPI	12556489, 21518769, 34847777
GO:0016020	Component	Membrane	IDA	21518769
GO:0016020	Component	Membrane	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	IDA	11564868, 12556489
GO:0019888	Function	Protein phosphatase regulator activity	ISS	11381086
GO:0019901	Function	Protein kinase binding	IPI	11517336
GO:0032058	Process	Positive regulation of translational initiation in response to stress	IDA	12556489
GO:0034976	Process	Response to endoplasmic reticulum stress	IBA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	12556489
GO:0036490	Process	Regulation of translation in response to endoplasmic reticulum stress	IDA	21518769
GO:0043558	Process	Regulation of translational initiation in response to stress	IDA	11564868
GO:0043558	Process	Regulation of translational initiation in response to stress	ISS	11381086
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	9153226
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	22934019
GO:0070972	Process	Protein localization to endoplasmic reticulum	IMP	12556489
GO:0071074	Function	Eukaryotic initiation factor eIF2 binding	IPI	34847777
GO:0072542	Function	Protein phosphatase activator activity	IDA	21518769
GO:1901798	Process	Positive regulation of signal transduction by p53 class mediator	ISS	14635196
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	TAS	22013210

Other IDs

• MIM: 611048
• HGNC: 14375
• e!Ensembl: ENSG00000087074

Protein

• UniProt ID: O75807
• Protein name: Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)
• Protein function: Recruits the serine/threonine-protein phosphatase PPP1CA to prevents excessive phosphorylation of the translation initiation factor eIF-2A/EIF2S1, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and faci
• PDB: 4XPN , 7NXV , 7NZM , 8QZZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10488	PP1c_bdg	541 → 619	Phosphatase-1 catalytic subunit binding region	Domain

• Sequence:

  MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGL
  EGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGE
  REATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYP
  PSHRECCPAVEEEDDEEAVKKEAHRTSTSALSPGSKPSTWVSCPGEEENQATEDKRTERS
  KGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLK
  SWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDE
  DSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSA
  STPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFR
  GWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPET
  PTHDPDPETPLKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQ
  EELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLSQAVATPSRSS
  AAAAAALDLSGRRG

• Sequence length: 674

Pathways

KEGG Pathway:

Protein processing in endoplasmic reticulum

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (52)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	28666219	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	27802424		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26142647		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26829377	Stimulate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31749592		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30782845	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25115793		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27802424		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28129777		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25014110		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16337513		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39742022	Associate	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	Pubtator	30415257	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32965004	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29212034		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37880674	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28635009		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29511029		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29511029		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31952466	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30415257		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31749592		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10490642, 36129940	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20858700	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28635009, 30782845		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35501353	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27492607	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28635009		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25115793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20043261		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15059970, 19276161		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27802424		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12168790		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20022965	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23412101	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16294031	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	30923003		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	27387891	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	27387891		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16337513		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12813455, 15059970, 27177629		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11163539		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28139216, 28635009		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25115793		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29432724		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26829377		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27177629		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28635009		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20043261		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20043261		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	17273797		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PPP1R15A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PPP1R15A.