Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	333926
Gene name	Protein phosphatase, Mg2+/Mn2+ dependent 1J
Gene symbol	PPM1J
Synonyms (NCBI Gene)	PP2C-zetaPP2CZPP2CzetaPPP2CZ
Chromosome	1
Chromosome location	1p13.2
Summary	This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known. [provided by RefSeq, Jul 2008]

10 Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT1254537	hsa-miR-3154	CLIP-seq
MIRT1254538	hsa-miR-4270	CLIP-seq
MIRT1254539	hsa-miR-4441	CLIP-seq
MIRT1254540	hsa-miR-549	CLIP-seq
MIRT1254538	hsa-miR-4270	CLIP-seq
MIRT1254539	hsa-miR-4441	CLIP-seq
MIRT1254540	hsa-miR-549	CLIP-seq
MIRT1254538	hsa-miR-4270	CLIP-seq
MIRT1254539	hsa-miR-4441	CLIP-seq
MIRT1254540	hsa-miR-549	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004741	Function	[pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
609957	20785	ENSG00000155367

Q5JR12

Protein name

Protein phosphatase 1J (EC 3.1.3.16) (Protein phosphatase 2C isoform zeta) (PP2C-zeta)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00481	PP2C	209 → 315	Protein phosphatase 2C	Family
PF00481	PP2C	357 → 470	Protein phosphatase 2C	Family

Sequence

MLNRVRSAVAHLVSSGGAPPPRPKSPDLPNAASAPPAAAPEAPRSPPAKAGSGSATPAKA
VEARASFSRPTFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE
DQACCEVVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQ
LKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAF
QLMDEQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNGEIIPMSREFTPE
TERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLR
FPLVCGEGKKARVMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPD
DVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRL
PNNKLGSGDDISVFVIPLGGPGSYS

Sequence length

505

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31650199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with PPM1J across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PPM1J.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PPM1J (see Related Genes above), that are NOT already directly curated for PPM1J itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PPM1J.

PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J)

Bookmark This Gene