PPIP5K1 (diphosphoinositol pentakisphosphate kinase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9677
• Gene name: Diphosphoinositol pentakisphosphate kinase 1
• Gene symbol: PPIP5K1
• Synonyms (NCBI Gene): HISPPD2A, IP6K, IPS1, VIP1, hsVIP1
• Chromosome: 15
• Chromosome location: 15q15.3
• Summary: This gene encodes a dual functional inositol kinase. The encoded enzyme converts inositol hexakisphosphate to diphosphoinositol pentakisphosphate and diphosphoinositol pentakisphosphate to bis-diphosphoinositol tetrakisphosphate. This protein may be impor

miRNA Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1253434	hsa-miR-124	CLIP-seq
MIRT1253435	hsa-miR-1245b-3p	CLIP-seq
MIRT1253436	hsa-miR-1827	CLIP-seq
MIRT1253437	hsa-miR-190	CLIP-seq
MIRT1253438	hsa-miR-190b	CLIP-seq
MIRT1253439	hsa-miR-2110	CLIP-seq
MIRT1253440	hsa-miR-298	CLIP-seq
MIRT1253441	hsa-miR-3150a-3p	CLIP-seq
MIRT1253442	hsa-miR-3154	CLIP-seq
MIRT1253443	hsa-miR-3179	CLIP-seq
MIRT1253444	hsa-miR-3187-3p	CLIP-seq
MIRT1253445	hsa-miR-3202	CLIP-seq
MIRT1253446	hsa-miR-3591-5p	CLIP-seq
MIRT1253447	hsa-miR-3614-5p	CLIP-seq
MIRT1253448	hsa-miR-3677-5p	CLIP-seq
MIRT1253449	hsa-miR-3682-3p	CLIP-seq
MIRT1253450	hsa-miR-3688-3p	CLIP-seq
MIRT1253451	hsa-miR-3714	CLIP-seq
MIRT1253452	hsa-miR-3910	CLIP-seq
MIRT1253453	hsa-miR-4260	CLIP-seq
MIRT1253454	hsa-miR-4271	CLIP-seq
MIRT1253455	hsa-miR-4450	CLIP-seq
MIRT1253456	hsa-miR-4460	CLIP-seq
MIRT1253457	hsa-miR-4509	CLIP-seq
MIRT1253458	hsa-miR-4529-5p	CLIP-seq
MIRT1253459	hsa-miR-4533	CLIP-seq
MIRT1253460	hsa-miR-4688	CLIP-seq
MIRT1253461	hsa-miR-4725-3p	CLIP-seq
MIRT1253462	hsa-miR-4727-3p	CLIP-seq
MIRT1253463	hsa-miR-4744	CLIP-seq
MIRT1253464	hsa-miR-4747-5p	CLIP-seq
MIRT1253465	hsa-miR-506	CLIP-seq
MIRT2457008	hsa-miR-3194-3p	CLIP-seq
MIRT2457009	hsa-miR-4274	CLIP-seq
MIRT2457010	hsa-miR-4427	CLIP-seq
MIRT2457011	hsa-miR-450b-5p	CLIP-seq
MIRT2457012	hsa-miR-4680-3p	CLIP-seq
MIRT2457013	hsa-miR-507	CLIP-seq
MIRT2457014	hsa-miR-557	CLIP-seq
MIRT1253434	hsa-miR-124	CLIP-seq
MIRT1253435	hsa-miR-1245b-3p	CLIP-seq
MIRT1253436	hsa-miR-1827	CLIP-seq
MIRT1253437	hsa-miR-190	CLIP-seq
MIRT1253438	hsa-miR-190b	CLIP-seq
MIRT1253439	hsa-miR-2110	CLIP-seq
MIRT1253440	hsa-miR-298	CLIP-seq
MIRT1253441	hsa-miR-3150a-3p	CLIP-seq
MIRT1253442	hsa-miR-3154	CLIP-seq
MIRT1253443	hsa-miR-3179	CLIP-seq
MIRT1253444	hsa-miR-3187-3p	CLIP-seq
MIRT1253445	hsa-miR-3202	CLIP-seq
MIRT1253446	hsa-miR-3591-5p	CLIP-seq
MIRT1253447	hsa-miR-3614-5p	CLIP-seq
MIRT1253448	hsa-miR-3677-5p	CLIP-seq
MIRT1253449	hsa-miR-3682-3p	CLIP-seq
MIRT1253450	hsa-miR-3688-3p	CLIP-seq
MIRT1253451	hsa-miR-3714	CLIP-seq
MIRT1253452	hsa-miR-3910	CLIP-seq
MIRT1253453	hsa-miR-4260	CLIP-seq
MIRT1253455	hsa-miR-4450	CLIP-seq
MIRT1253456	hsa-miR-4460	CLIP-seq
MIRT1253457	hsa-miR-4509	CLIP-seq
MIRT1253458	hsa-miR-4529-5p	CLIP-seq
MIRT1253459	hsa-miR-4533	CLIP-seq
MIRT1253460	hsa-miR-4688	CLIP-seq
MIRT1253462	hsa-miR-4727-3p	CLIP-seq
MIRT1253463	hsa-miR-4744	CLIP-seq
MIRT1253465	hsa-miR-506	CLIP-seq
MIRT1253436	hsa-miR-1827	CLIP-seq
MIRT1253439	hsa-miR-2110	CLIP-seq
MIRT1253440	hsa-miR-298	CLIP-seq
MIRT1253441	hsa-miR-3150a-3p	CLIP-seq
MIRT1253442	hsa-miR-3154	CLIP-seq
MIRT1253443	hsa-miR-3179	CLIP-seq
MIRT1253447	hsa-miR-3614-5p	CLIP-seq
MIRT1253449	hsa-miR-3682-3p	CLIP-seq
MIRT1253455	hsa-miR-4450	CLIP-seq
MIRT1253460	hsa-miR-4688	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	IDA	17412958
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IDA	17690096
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IEA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	TAS
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	IEA
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	TAS
GO:0000832	Function	Inositol hexakisphosphate 5-kinase activity	IDA	17412958
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	17690096, 17702752
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006020	Process	Inositol metabolic process	IDA	17412958
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA
GO:0033857	Function	5-diphosphoinositol pentakisphosphate 1-kinase activity	IBA
GO:0033857	Function	5-diphosphoinositol pentakisphosphate 1-kinase activity	IDA	17412958
GO:0033857	Function	5-diphosphoinositol pentakisphosphate 1-kinase activity	IEA
GO:0043647	Process	Inositol phosphate metabolic process	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0052723	Function	Inositol hexakisphosphate 1-kinase activity	IEA

Other IDs

• MIM: 610979
• HGNC: 29023
• e!Ensembl: ENSG00000168781

Protein

• UniProt ID: Q6PFW1
• Protein name: Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (EC 2.7.4.24) (Diphosphoinositol pentakisphosphate kinase 1) (Histidine acid phosphatase domain-containing protein 2A) (IP6 kinase) (Inositol pyrophosphate synthase 1) (InsP6 and P
• Protein function: Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrak
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00328	His_Phos_2	390 → 910	Histidine phosphatase superfamily (branch 2)	Family
  PF18086	PPIP5K2_N	55 → 144	Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with a higher expression in skeletal muscle, heart and brain. {ECO:0000269|PubMed:17690096}.
• Sequence:

  MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC
  AMTKKSKSKPMTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDK
  AVAYSKLRNPFLINDLAMQYYIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEG
  EDQVEVNGAVFPKPFVEKPVSAEDHNVYIYYPSSAGGGSQRLFRKIGSRSSVYSPESSVR
  KTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEIRYPVMLTAM
  EKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCAKILGNTIMRE
  LAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA
  LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMY
  GHFSGINRKVQLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGR
  AFRCMYPGGQGDYAGFPGCGLLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGEL
  TPILVQMVKSANMNGLLDSDGDSLSSCQHRVKARLHHILQQDAPFGPEDYDQLAPTRSTS
  LLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVDLQLYHSETLELMLQRWSKLE
  RDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADVVIPQEYGISR
  EEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT
  SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSE
  ERFHVELHFSPGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRA
  LQTSPQPPEGPGLPRRSPLIRNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLG
  SQCTGLFSTTVLGGSSSAPNLQDYARSHGKKLPPASLKHRDELLFVPAVKRFSVSFAKHP
  TNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHTDAQAQASAALFDSMHSSQAS
  DNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNSQFGFSDQPSL
  NSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE
  VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKV
  SEEVCQLCLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVI
  QPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN

• Sequence length: 1433

Pathways

KEGG Pathway:

Phosphatidylinositol signaling system

Reactome Pathway:

Synthesis of pyrophosphates in the cytosol

Related Genes

Sort by: Blended Diseases Pathways Evidence source

IP6K3 2 shared pathwaysPhosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol Related via 2 shared pathways including Phosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol. PPIP5K2 2 shared pathwaysPhosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol Related via 2 shared pathways including Phosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol. IP6K1 2 shared pathwaysPhosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol Related via 2 shared pathways including Phosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol. IPPK 2 shared pathwaysPhosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol Related via 2 shared pathways including Phosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol. ITPK1 2 shared pathwaysPhosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol Related via 2 shared pathways including Phosphatidylinositol signaling system, Synthesis of pyrophosphates in the cytosol.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IP6K3	0	[]	2	["Phosphatidylinositol signaling system","Synthesis of pyrophosphates in the cytosol"]	0	[]
PPIP5K2	0	[]	2	["Phosphatidylinositol signaling system","Synthesis of pyrophosphates in the cytosol"]	0	[]
IP6K1	0	[]	2	["Phosphatidylinositol signaling system","Synthesis of pyrophosphates in the cytosol"]	0	[]
IPPK	0	[]	2	["Phosphatidylinositol signaling system","Synthesis of pyrophosphates in the cytosol"]	0	[]
ITPK1	0	[]	2	["Phosphatidylinositol signaling system","Synthesis of pyrophosphates in the cytosol"]	0	[]

Diseases Linked via Similar Genes

Obstructive pulmonary disease Linked via 3 of 5 related genesIP6K3, IP6K1, ITPK1 Insomnia Linked via 3 of 5 related genesIP6K3, PPIP5K2, IP6K1 Asthma Linked via 2 of 5 related genesIP6K3, ITPK1 Hypothyroidism Linked via 2 of 5 related genesIP6K3, ITPK1 Diabetes mellitus type 2 Linked via 2 of 5 related genesIP6K3, PPIP5K2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obstructive pulmonary disease	3	["IP6K3","IP6K1","ITPK1"]
Insomnia	3	["IP6K3","PPIP5K2","IP6K1"]
Asthma	2	["IP6K3","ITPK1"]
Hypothyroidism	2	["IP6K3","ITPK1"]
Diabetes mellitus type 2	2	["IP6K3","PPIP5K2"]