Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	105371242
Gene name	Peptidylprolyl isomerase A like 4H
Gene symbol	PPIAL4H
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q21.1

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0016018	Function	Cyclosporin A binding	IBA
GO:0016853	Function	Isomerase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

A0A075B767

Protein name

Peptidyl-prolyl cis-trans isomerase A-like 4H (PPIase A-like 4H) (EC 5.2.1.8)

Protein function

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00160	Pro_isomerase	7 → 163	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	Domain

Sequence

MVNSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGF
MCQGGDFTRPNGTDDKSIYGEKFDDENLIRKHTGSGILSMVNAGPNTNGSQLFICTAKTE
WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF

Sequence length

164

Interactions

View interactions

Related Genes Genes most often co-reported with PPIAL4H across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PPIAL4H.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PPIAL4H (see Related Genes above), that are NOT already directly curated for PPIAL4H itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PPIAL4H.

PPIAL4H (peptidylprolyl isomerase A like 4H)

Save This Analysis