Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	653505
Gene name	Peptidylprolyl isomerase A like 4A
Gene symbol	PPIAL4A
Synonyms (NCBI Gene)	COAS-2COAS2PPIAL4PPIAL4B
Chromosome	1
Chromosome location	1p11.2

23 Show/Hide all (23)

miRTarBase ID	miRNA	Experiments
MIRT1252713	hsa-miR-1200	CLIP-seq
MIRT1252714	hsa-miR-1976	CLIP-seq
MIRT1252715	hsa-miR-3165	CLIP-seq
MIRT1252716	hsa-miR-342-5p	CLIP-seq
MIRT1252717	hsa-miR-3907	CLIP-seq
MIRT1252718	hsa-miR-4324	CLIP-seq
MIRT1252719	hsa-miR-4664-5p	CLIP-seq
MIRT1252720	hsa-miR-544b	CLIP-seq
MIRT1252721	hsa-miR-548v	CLIP-seq
MIRT1252722	hsa-miR-610	CLIP-seq
MIRT1252713	hsa-miR-1200	CLIP-seq
MIRT2301379	hsa-miR-1252	CLIP-seq
MIRT2301380	hsa-miR-193a-5p	CLIP-seq
MIRT1252714	hsa-miR-1976	CLIP-seq
MIRT1252715	hsa-miR-3165	CLIP-seq
MIRT1252716	hsa-miR-342-5p	CLIP-seq
MIRT1252717	hsa-miR-3907	CLIP-seq
MIRT1252718	hsa-miR-4324	CLIP-seq
MIRT2301381	hsa-miR-4506	CLIP-seq
MIRT1252719	hsa-miR-4664-5p	CLIP-seq
MIRT1252720	hsa-miR-544b	CLIP-seq
MIRT1252721	hsa-miR-548v	CLIP-seq
MIRT1252722	hsa-miR-610	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0016018	Function	Cyclosporin A binding	IBA
GO:0016853	Function	Isomerase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9Y536

Protein name

Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIase A-like 4A) (EC 5.2.1.8) (Chromosome one-amplified sequence 2) (COAS-2) (Cyclophilin homolog overexpressed in liver cancer)

Protein function

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00160	Pro_isomerase	7 → 163	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain, ovary and mammary gland. Moderately expressed in lung, salivary gland, kidney, skin, adipose tissue, intestine and spleen. Weakly expressed in skeletal muscle, liver and stomach. Expressed in pleiomorphic and

Sequence

MVNSVVFFDITVDGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGF
MCQGGDFTRHNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTE
WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF

Sequence length

164

Interactions

View interactions

Related Genes Genes most often co-reported with PPIAL4A across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for PPIAL4A.

Diseases Linked via Similar Genes Diseases curated for genes most similar to PPIAL4A (see Related Genes above), that are NOT already directly curated for PPIAL4A itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to PPIAL4A.

PPIAL4A (peptidylprolyl isomerase A like 4A)

Bookmark This Gene