PPEF1 (protein phosphatase with EF-hand domain 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5475
Gene name Protein phosphatase with EF-hand domain 1
Gene symbol PPEF1
Synonyms (NCBI Gene)
PP7PPEFPPP7CPPP7CA
Chromosome X
Chromosome location Xp22.13
Summary This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1252371 hsa-miR-4264 CLIP-seq
MIRT1252372 hsa-miR-4704-3p CLIP-seq
MIRT1252373 hsa-miR-668 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IBA
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity TAS 9215685
GO:0005506 Function Iron ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300109 9243 ENSG00000086717
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14829
Protein name Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7)
Protein function May have a role in the recovery or adaptation response of photoreceptors. May have a role in development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 570 → 598 EF hand Domain
PF00149 Metallophos 165 → 407 Calcineurin-like phosphoesterase Domain
PF00612 IQ 17 → 37 IQ calmodulin-binding motif Motif
PF08321 PPP5 81 → 158 PPP5 TPR repeat region Family
Tissue specificity TISSUE SPECIFICITY: Detected in retina and retinal derived Y-79 retinoblastoma cells. Also found in fetal brain.
Sequence 
MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLS
TFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTD
IDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDL
FLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMN
LRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRV
ERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDIL
WSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVT
IFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRER
VISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEY
MSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSS
HYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVTNLG
Sequence length 653
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Inactivation, recovery and regulation of the phototransduction cascade

No strongly related genes found yet for PPEF1.

No additional diseases found yet through genes similar to PPEF1.