Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	10891
Gene name	PPARG coactivator 1 alpha
Gene symbol	PPARGC1A
Synonyms (NCBI Gene)	LEM6PGC-1(alpha)PGC-1alphaPGC-1vPGC1PGC1APPARGC1
Chromosome	4
Chromosome location	4p15.2
Summary	The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protei

489

Show/Hide all (489)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT017345	hsa-miR-335-5p	Microarray	18185580
MIRT027602	hsa-miR-98-5p	Microarray	19088304
MIRT051970	hsa-let-7b-5p	CLASH	23622248
MIRT043961	hsa-miR-378a-5p	CLASH	23622248
MIRT042423	hsa-miR-425-3p	CLASH	23622248
MIRT039358	hsa-miR-421	CLASH	23622248
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	23868745
MIRT725214	hsa-miR-8485	HITS-CLIP	19536157
MIRT725213	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT725212	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT725211	hsa-miR-603	HITS-CLIP	19536157
MIRT725210	hsa-miR-4789-3p	HITS-CLIP	19536157
MIRT725209	hsa-miR-8064	HITS-CLIP	19536157
MIRT725208	hsa-miR-3941	HITS-CLIP	19536157
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521784	hsa-miR-6083	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521789	hsa-miR-32-3p	HITS-CLIP	22927820
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT521786	hsa-miR-4775	HITS-CLIP	22927820
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT521784	hsa-miR-6083	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT521784	hsa-miR-6083	HITS-CLIP	23313552
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521784	hsa-miR-6083	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521789	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521787	hsa-miR-3124-3p	PAR-CLIP	23446348
MIRT521786	hsa-miR-4775	PAR-CLIP	23446348
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521784	hsa-miR-6083	PAR-CLIP	23446348
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT731334	hsa-miR-485-3p	Luciferase reporter assay	27010860
MIRT731334	hsa-miR-485-3p	Luciferase reporter assay	27010860
MIRT731335	hsa-miR-485-5p	Luciferase reporter assay	27010860
MIRT731335	hsa-miR-485-5p	Luciferase reporter assay	27010860
MIRT735309	hsa-miR-3619-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRFlow cytometry	32300102
MIRT737820	hsa-miR-211	HITS-CLIP	33718276
MIRT737822	hsa-miR-623	HITS-CLIP	33718276
MIRT725214	hsa-miR-8485	HITS-CLIP	19536157
MIRT725213	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT725212	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT725211	hsa-miR-603	HITS-CLIP	19536157
MIRT725210	hsa-miR-4789-3p	HITS-CLIP	19536157
MIRT725209	hsa-miR-8064	HITS-CLIP	19536157
MIRT725208	hsa-miR-3941	HITS-CLIP	19536157
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521784	hsa-miR-6083	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521789	hsa-miR-32-3p	HITS-CLIP	22927820
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT521786	hsa-miR-4775	HITS-CLIP	22927820
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT521784	hsa-miR-6083	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT521784	hsa-miR-6083	HITS-CLIP	23313552
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521784	hsa-miR-6083	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521789	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521787	hsa-miR-3124-3p	PAR-CLIP	23446348
MIRT521786	hsa-miR-4775	PAR-CLIP	23446348
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521784	hsa-miR-6083	PAR-CLIP	23446348
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT755680	hsa-miR-193b-3p	Luciferase reporter assayWestern blottingqRT-PCR	36835287
MIRT1251822	hsa-miR-1273g	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT737819	hsa-miR-204	CLIP-seq
MIRT1251825	hsa-miR-2052	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251832	hsa-miR-3074-3p	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT1251838	hsa-miR-3163	CLIP-seq
MIRT1251839	hsa-miR-323b-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT737823	hsa-miR-4446-5p	CLIP-seq
MIRT1251844	hsa-miR-4461	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT1251846	hsa-miR-4668-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT737821	hsa-miR-4755-5p	CLIP-seq
MIRT1251848	hsa-miR-4797-5p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT737825	hsa-miR-494	CLIP-seq
MIRT737824	hsa-miR-543	CLIP-seq
MIRT1251850	hsa-miR-660	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT1552511	hsa-miR-193a-3p	CLIP-seq
MIRT1552512	hsa-miR-193b	CLIP-seq
MIRT1552513	hsa-miR-200b	CLIP-seq
MIRT1552514	hsa-miR-200c	CLIP-seq
MIRT1552515	hsa-miR-429	CLIP-seq
MIRT1552516	hsa-miR-4662a-3p	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT2074250	hsa-miR-3607-3p	CLIP-seq
MIRT2074251	hsa-miR-3686	CLIP-seq
MIRT2074252	hsa-miR-371b-5p	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2074254	hsa-miR-4698	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2074257	hsa-miR-548c-3p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT2074259	hsa-miR-888	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT2301256	hsa-miR-1324	CLIP-seq
MIRT1552511	hsa-miR-193a-3p	CLIP-seq
MIRT1552512	hsa-miR-193b	CLIP-seq
MIRT1552513	hsa-miR-200b	CLIP-seq
MIRT1552514	hsa-miR-200c	CLIP-seq
MIRT2301257	hsa-miR-3153	CLIP-seq
MIRT2301258	hsa-miR-329	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT2301261	hsa-miR-3664-5p	CLIP-seq
MIRT1552515	hsa-miR-429	CLIP-seq
MIRT2301262	hsa-miR-4480	CLIP-seq
MIRT2301263	hsa-miR-4509	CLIP-seq
MIRT1552516	hsa-miR-4662a-3p	CLIP-seq
MIRT2301264	hsa-miR-4714-5p	CLIP-seq
MIRT2301265	hsa-miR-4727-5p	CLIP-seq
MIRT2301266	hsa-miR-4744	CLIP-seq
MIRT2301267	hsa-miR-4769-3p	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2301270	hsa-miR-671-5p	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT2074254	hsa-miR-4698	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT2597904	hsa-miR-139-5p	CLIP-seq
MIRT2597905	hsa-miR-151-3p	CLIP-seq
MIRT2597906	hsa-miR-196a	CLIP-seq
MIRT2597907	hsa-miR-196b	CLIP-seq
MIRT2597908	hsa-miR-19a	CLIP-seq
MIRT2597909	hsa-miR-19b	CLIP-seq
MIRT2597910	hsa-miR-2116	CLIP-seq
MIRT2597911	hsa-miR-2117	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2597912	hsa-miR-218	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT2597913	hsa-miR-3119	CLIP-seq
MIRT2597914	hsa-miR-3120-5p	CLIP-seq
MIRT2597915	hsa-miR-3145-5p	CLIP-seq
MIRT2597916	hsa-miR-3152-5p	CLIP-seq
MIRT2597917	hsa-miR-3177-5p	CLIP-seq
MIRT2597918	hsa-miR-3183	CLIP-seq
MIRT2597919	hsa-miR-3201	CLIP-seq
MIRT2597920	hsa-miR-324-5p	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT2597921	hsa-miR-3591-5p	CLIP-seq
MIRT2597922	hsa-miR-3613-3p	CLIP-seq
MIRT2597923	hsa-miR-3613-5p	CLIP-seq
MIRT2597924	hsa-miR-3616-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2597925	hsa-miR-3647-5p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT2597926	hsa-miR-3671	CLIP-seq
MIRT2597927	hsa-miR-3692	CLIP-seq
MIRT2597928	hsa-miR-3917	CLIP-seq
MIRT2597929	hsa-miR-3927	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT2597930	hsa-miR-410	CLIP-seq
MIRT2597931	hsa-miR-4273	CLIP-seq
MIRT2597932	hsa-miR-4280	CLIP-seq
MIRT2597933	hsa-miR-4282	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2597934	hsa-miR-4436b-5p	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT2597935	hsa-miR-4528	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT2597936	hsa-miR-4650-3p	CLIP-seq
MIRT2597937	hsa-miR-4670-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT2597938	hsa-miR-4677-5p	CLIP-seq
MIRT2597939	hsa-miR-4684-3p	CLIP-seq
MIRT2597940	hsa-miR-4690-3p	CLIP-seq
MIRT2597941	hsa-miR-4723-3p	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2597942	hsa-miR-4762-5p	CLIP-seq
MIRT2597943	hsa-miR-4766-3p	CLIP-seq
MIRT2597944	hsa-miR-4772-5p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2597945	hsa-miR-4791	CLIP-seq
MIRT2597946	hsa-miR-4795-3p	CLIP-seq
MIRT2597947	hsa-miR-4799-5p	CLIP-seq
MIRT2597948	hsa-miR-4802-3p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2597949	hsa-miR-513a-3p	CLIP-seq
MIRT2597950	hsa-miR-518a-5p	CLIP-seq
MIRT2597951	hsa-miR-527	CLIP-seq
MIRT2597952	hsa-miR-548a-5p	CLIP-seq
MIRT2597953	hsa-miR-548ab	CLIP-seq
MIRT2597954	hsa-miR-548ak	CLIP-seq
MIRT2597955	hsa-miR-548b-5p	CLIP-seq
MIRT2597956	hsa-miR-548c-5p	CLIP-seq
MIRT2597957	hsa-miR-548d-5p	CLIP-seq
MIRT2597958	hsa-miR-548h	CLIP-seq
MIRT2597959	hsa-miR-548i	CLIP-seq
MIRT2597960	hsa-miR-548j	CLIP-seq
MIRT2597961	hsa-miR-548k	CLIP-seq
MIRT2597962	hsa-miR-548l	CLIP-seq
MIRT2597963	hsa-miR-548p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT2597964	hsa-miR-548w	CLIP-seq
MIRT2597965	hsa-miR-548y	CLIP-seq
MIRT2597966	hsa-miR-559	CLIP-seq
MIRT2597967	hsa-miR-562	CLIP-seq
MIRT2597968	hsa-miR-573	CLIP-seq
MIRT2597969	hsa-miR-578	CLIP-seq
MIRT2597970	hsa-miR-593	CLIP-seq
MIRT2597971	hsa-miR-636	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2597972	hsa-miR-642b	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT2597973	hsa-miR-654-3p	CLIP-seq
MIRT2597974	hsa-miR-7	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT2597904	hsa-miR-139-5p	CLIP-seq
MIRT2597905	hsa-miR-151-3p	CLIP-seq
MIRT2597906	hsa-miR-196a	CLIP-seq
MIRT2597907	hsa-miR-196b	CLIP-seq
MIRT2597908	hsa-miR-19a	CLIP-seq
MIRT2597909	hsa-miR-19b	CLIP-seq
MIRT1251825	hsa-miR-2052	CLIP-seq
MIRT2597910	hsa-miR-2116	CLIP-seq
MIRT2597911	hsa-miR-2117	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2597912	hsa-miR-218	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT2688405	hsa-miR-2276	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251832	hsa-miR-3074-3p	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT2597913	hsa-miR-3119	CLIP-seq
MIRT2597914	hsa-miR-3120-5p	CLIP-seq
MIRT2688406	hsa-miR-3121-3p	CLIP-seq
MIRT2597915	hsa-miR-3145-5p	CLIP-seq
MIRT2597916	hsa-miR-3152-5p	CLIP-seq
MIRT2301257	hsa-miR-3153	CLIP-seq
MIRT2597917	hsa-miR-3177-5p	CLIP-seq
MIRT2597918	hsa-miR-3183	CLIP-seq
MIRT2597919	hsa-miR-3201	CLIP-seq
MIRT2688407	hsa-miR-323-3p	CLIP-seq
MIRT2597920	hsa-miR-324-5p	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT2597921	hsa-miR-3591-5p	CLIP-seq
MIRT2074250	hsa-miR-3607-3p	CLIP-seq
MIRT2597922	hsa-miR-3613-3p	CLIP-seq
MIRT2597923	hsa-miR-3613-5p	CLIP-seq
MIRT2597924	hsa-miR-3616-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2597925	hsa-miR-3647-5p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT2301261	hsa-miR-3664-5p	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT2597926	hsa-miR-3671	CLIP-seq
MIRT2597927	hsa-miR-3692	CLIP-seq
MIRT2688408	hsa-miR-369-3p	CLIP-seq
MIRT2688409	hsa-miR-374a	CLIP-seq
MIRT2688410	hsa-miR-374b	CLIP-seq
MIRT2597928	hsa-miR-3917	CLIP-seq
MIRT2597929	hsa-miR-3927	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT2597930	hsa-miR-410	CLIP-seq
MIRT2597931	hsa-miR-4273	CLIP-seq
MIRT2597932	hsa-miR-4280	CLIP-seq
MIRT2597933	hsa-miR-4282	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2597934	hsa-miR-4436b-5p	CLIP-seq
MIRT2301262	hsa-miR-4480	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT2597935	hsa-miR-4528	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT2597936	hsa-miR-4650-3p	CLIP-seq
MIRT1251846	hsa-miR-4668-3p	CLIP-seq
MIRT2597937	hsa-miR-4670-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT2597938	hsa-miR-4677-5p	CLIP-seq
MIRT2597939	hsa-miR-4684-3p	CLIP-seq
MIRT2688411	hsa-miR-4686	CLIP-seq
MIRT2597940	hsa-miR-4690-3p	CLIP-seq
MIRT2688412	hsa-miR-4700-3p	CLIP-seq
MIRT2301264	hsa-miR-4714-5p	CLIP-seq
MIRT2597941	hsa-miR-4723-3p	CLIP-seq
MIRT2301265	hsa-miR-4727-5p	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2597942	hsa-miR-4762-5p	CLIP-seq
MIRT2597943	hsa-miR-4766-3p	CLIP-seq
MIRT2301267	hsa-miR-4769-3p	CLIP-seq
MIRT2688413	hsa-miR-4772-3p	CLIP-seq
MIRT2597944	hsa-miR-4772-5p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2688414	hsa-miR-4789-5p	CLIP-seq
MIRT2597945	hsa-miR-4791	CLIP-seq
MIRT2597946	hsa-miR-4795-3p	CLIP-seq
MIRT2597947	hsa-miR-4799-5p	CLIP-seq
MIRT2597948	hsa-miR-4802-3p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2597949	hsa-miR-513a-3p	CLIP-seq
MIRT2597950	hsa-miR-518a-5p	CLIP-seq
MIRT2597951	hsa-miR-527	CLIP-seq
MIRT2597952	hsa-miR-548a-5p	CLIP-seq
MIRT2597953	hsa-miR-548ab	CLIP-seq
MIRT2597954	hsa-miR-548ak	CLIP-seq
MIRT2597955	hsa-miR-548b-5p	CLIP-seq
MIRT2074257	hsa-miR-548c-3p	CLIP-seq
MIRT2597956	hsa-miR-548c-5p	CLIP-seq
MIRT2597957	hsa-miR-548d-5p	CLIP-seq
MIRT2597958	hsa-miR-548h	CLIP-seq
MIRT2597959	hsa-miR-548i	CLIP-seq
MIRT2597960	hsa-miR-548j	CLIP-seq
MIRT2597961	hsa-miR-548k	CLIP-seq
MIRT2597962	hsa-miR-548l	CLIP-seq
MIRT2597963	hsa-miR-548p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT2597964	hsa-miR-548w	CLIP-seq
MIRT2597965	hsa-miR-548y	CLIP-seq
MIRT2597966	hsa-miR-559	CLIP-seq
MIRT2597967	hsa-miR-562	CLIP-seq
MIRT2597968	hsa-miR-573	CLIP-seq
MIRT2688415	hsa-miR-577	CLIP-seq
MIRT2597969	hsa-miR-578	CLIP-seq
MIRT2597970	hsa-miR-593	CLIP-seq
MIRT2597971	hsa-miR-636	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2597972	hsa-miR-642b	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT2597973	hsa-miR-654-3p	CLIP-seq
MIRT2597974	hsa-miR-7	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT2688416	hsa-miR-891b	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
CRTC1	Activation	10893434
MEF2A	Unknown	18222924
MITF	Activation	23416000
TP53	Unknown	19139068

Show/Hide all (91)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IC	27471003
GO:0001659	Process	Temperature homeostasis	TAS	1258810
GO:0001678	Process	Intracellular glucose homeostasis	NAS	11854298
GO:0002021	Process	Response to dietary excess	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	10713165
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003712	Function	Transcription coregulator activity	ISS
GO:0003712	Function	Transcription coregulator activity	TAS	14636573
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	16488887, 16753578, 19651776, 21376232, 27471003
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	12588810
GO:0005515	Function	Protein binding	IPI	12522104, 15337744, 17050673, 18063693, 18441008, 19171140, 19846556, 19914244, 24907116, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10713165
GO:0005634	Component	Nucleus	IDA	23836911
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	12588810
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006094	Process	Gluconeogenesis	IDA	16753578, 23142079
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	NAS	11854298
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	27471003
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	23836911
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	TAS	14636573
GO:0006397	Process	MRNA processing	TAS	12588810
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	25118933
GO:0007005	Process	Mitochondrion organization	NAS	11854298
GO:0007586	Process	Digestion	TAS	10585775
GO:0008380	Process	RNA splicing	TAS	12588810
GO:0010628	Process	Positive regulation of gene expression	IDA	23525105
GO:0010628	Process	Positive regulation of gene expression	IMP	29182484
GO:0014850	Process	Response to muscle activity	IEA
GO:0014850	Process	Response to muscle activity	ISS
GO:0016605	Component	PML body	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	18798693
GO:0019395	Process	Fatty acid oxidation	NAS	11854298
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0022904	Process	Respiratory electron transport chain	ISS
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031490	Function	Chromatin DNA binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22064484
GO:0032502	Process	Developmental process	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0042592	Process	Homeostatic process	IEA
GO:0042594	Process	Response to starvation	NAS	11854298
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	23836911
GO:0045333	Process	Cellular respiration	TAS	11551810
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	19651776
GO:0045722	Process	Positive regulation of gluconeogenesis	TAS	12588810
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16488887
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19651776, 21376232
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046321	Process	Positive regulation of fatty acid oxidation	TAS	12588810
GO:0048511	Process	Rhythmic process	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IMP	29182484
GO:0050821	Process	Protein stabilization	TAS	14636573
GO:0050873	Process	Brown fat cell differentiation	TAS	12588810
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	14636573
GO:0097009	Process	Energy homeostasis	IBA
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097009	Process	Energy homeostasis	ISS
GO:0106222	Function	LncRNA binding	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15454086
GO:0140297	Function	DNA-binding transcription factor binding	TAS	12588810

MIM	HGNC	e!Ensembl
604517	9237	ENSG00000109819

Q9UBK2

Protein name

Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)

Protein function

Transcriptional coactivator for steroid receptors and nuclear receptors (PubMed:10713165, PubMed:20005308, PubMed:21376232, PubMed:28363985, PubMed:32433991). Greatly increases the transcriptional activity of PPARG and thyroid hormone receptor o

PDB

1XB7 , 3B1M , 3CS8 , 3D24 , 3U9Q , 3V9T , 3V9V , 4QJR , 4QK4 , 5Q0I , 5TWO , 5UNJ , 5Z5S , 5Z6S , 6AD9 , 6FZF , 6FZP , 6IZM , 6IZN , 6K0T , 6KXX , 6KXY , 6LN4 , 6MS7 , 6NWK , 6NWL , 6T1V , 6W9K , 6W9L , 7E2E , 7KHT , 7PRV , 7PRW , 7PRX , 8BF1 , 8DK4 , 9F7W , 9F7X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	679 → 742	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, skeletal muscle, liver and kidney. Expressed at lower levels in brain and pancreas and at very low levels in the intestine and white adipose tissue. In skeletal muscle, levels were lower in obese than in lean subjects and fastin

Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR

Sequence length

798

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (36)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOWEN'S DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BUNDLE BRANCH BLOCK	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL 1, INFANTILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPARGC1A-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (364)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	30221360, 30570131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25331784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	34373561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23335958, 29925537, 30087287, 30253279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22077634	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31081111, 31283791, 40642087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21799244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24398293, 28946859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	17362836		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20840068, 22560226, 22975021, 23147503, 23669350, 24398293, 28603486, 29282717, 29580918		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	23669350		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	25892363	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28005993	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	23438894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	31252163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27344146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29717226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16902166, 27016616, 27312223, 30858489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26688517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16902166, 27016616, 27312223, 30858489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19322023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24463787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	22272266	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37407249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28694700		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28711948, 29115599, 29729707, 29861101, 30664159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	31432248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	27324142, 29502862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27324142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	30075123	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	21514422	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bowen`s Disease	Bowen`s Disease	CTD_human_DG	21514422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31629659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	16704985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12866036, 16704985, 22703186, 27102200, 27916422, 28988825, 29566941, 29930100, 31046734, 31154462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22234241, 22703186, 23172368, 24403067, 27746856, 36069230, 36114448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	31702508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18242180	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21855427, 28051997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16891307, 19793803, 20044617, 26380295, 33910445, 34981667, 37903974, 38019226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18242180, 28381162, 33276082	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	32801084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28803067, 31451071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21447778, 25243473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25243473, 30406665, 34870494, 37940720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37856813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21447778, 30244973, 31547300, 31657115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36378046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	15297879, 21325336, 23723143, 29931052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	17018837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32460327	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	18791640	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	23954821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28883902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18162502, 28550474, 28946859, 30829051		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18162502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18162502, 25923461	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16902166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30259675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	34373561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	34176131	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29859976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28533333	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis, neuronal 1, infantile	Neuronal ceroid lipofuscinosis	CTD_human_DG	21224254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29035878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	16506961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	16506961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29360226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	16506961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30638602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28550474, 29602395, 30829051, 31083336, 31614978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20732852, 20807714, 28895883, 28951138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31389320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33686088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14670614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32744303, 37023088, 37543674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16395669, 28051997, 28740336, 29130104, 29566941, 29789344, 30838172, 30959809, 31519589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17341490, 28051997, 29973580, 30959809, 32828126, 34080453, 34169901, 34702278, 35792657, 35896535, 39210159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	29535452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	20699619	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15297879, 16511594, 20339121, 22912857, 22939990, 27876471, 28302481, 28824327, 29901150, 29931052, 30638602, 30798619, 31133853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	19808358, 22503866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26119730, 31469445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18565194, 20512451, 27016616, 28533333, 29334584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18565194, 20512451, 27016616, 28533333, 29334584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27542888, 28533333	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27542888	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18565194, 27016616, 28533333, 29334584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	27486743	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31018035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	19297390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25047750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	19273754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	25492529	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21630437, 30191781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32998701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12808457, 12832613, 14522988, 15546003, 15912394, 16403952, 16511594, 17018837, 17031255, 17548123, 18279023, 19077249, 20032281, 20359506, 25260493 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25437179	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	11793024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12397057, 15705733, 16326070, 16538490, 18162502, 19077249, 19723495, 22174922, 22955979, 24317794, 27542888, 27699582, 32867330, 36594575, 36768561, 36835287 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12808457, 12832613, 14522988, 15546003, 15912394, 16403952, 16511594, 17018837, 17031255, 17548123, 18279023, 19077249, 20032281, 20359506, 24463787 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12832613, 28864016	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15545992, 16326070, 17327455, 27542888, 31015797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15546003, 15581067, 15705733, 16403952, 16538490, 17216277, 18162502, 18614852, 19723495, 20032281, 22684233, 22955979, 23133645, 23251491, 23505498 View all (15 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23805175	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18385139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11793024, 12107756, 12606537, 12832613, 15107844, 15111510, 15146371, 15545992, 15581067, 15592662, 15599700, 15649578, 15782399, 15824463, 15912394 View all (60 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15592662, 17317762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17390150, 17701054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Diabetic foot	Pubtator	26579581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23949796, 27825100	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19900151, 25853493, 27825100, 28956034, 29344670, 30187480, 30668374, 30671964, 30876865, 31402864, 31734944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28528294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	15782399, 25324196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29115286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	34009292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	23141926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	16122414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23291000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28087733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32867330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	30071860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	23406886, 31410709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31040369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	24654751, 31119261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24654751, 31119261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39244839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21447778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15824463, 24718382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	27797806, 29899728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	27797806, 28801652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	15920699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	22973467, 25815108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	17216277, 26999124, 27015186, 34321850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	18588668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20529956, 20890895, 28540526, 29882814, 30871963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27015186, 29602237, 30518830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29312518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	20383327, 21687738		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	20383327, 31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34184087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28076790, 30578297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30578297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30578297		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	30578297	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	23335958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	32051464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	20529956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	31173325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	20368732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	21687738, 32460327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12397057, 19061896, 24704539, 32460327	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	15297879, 16511594, 20339121, 22912857, 22939990, 27876471, 28302481, 28824327, 29901150, 29931052, 30798619, 31133853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	19808358, 22503866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	24825877, 28824327	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	19808358, 22503866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoid	Pubtator	37932969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25762623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	37181035	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28550474, 29491012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17018277, 17081970, 18090434, 19118529, 19460884, 20108082, 20529956, 20556492, 20736066, 20840068, 22100502, 22589246, 22825315, 23373812, 24383721 View all (12 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	LHGDN	19118529		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	19118529, 22825315, 24383721, 36902304	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	16380484, 25695395, 27388218, 28433632, 31184310, 31529536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27340502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28433632	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31269408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	15546003, 17563064, 19913841, 28349667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17971240, 18614852, 19077249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28824327	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12574109, 15599700, 15649578, 15738346, 15824463, 16216916, 17579564, 17971240, 18614852, 19077249, 20944660, 22194199, 24718382, 25773007, 27616627 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	12574109, 15599700, 15738346, 16216916, 17971240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30541949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	17579564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	28591028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28536504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22973467	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30578297, 36429023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35692078	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22973467, 29369849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	22973467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25585584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28377712, 29971668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	12832613, 16326070, 16403952, 19966034, 20739510, 24317794, 25282005, 27955950, 35205333, 37730054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17563058, 18182465, 21266331, 21701566, 22323564	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31238070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kearns-Sayre syndrome	Kearns Sayre Syndrome	BEFREE	27179217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22684233, 29602395, 31313501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	22684233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33790861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	13680532, 28569136, 30982966, 31055583, 31105043, 31164200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21162720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17579564, 24718382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	19808358, 22503866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	33771987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37932969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	30236862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31734944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	21078971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19376136, 22318941, 26380295, 28191864, 28381162, 29361788, 30518830, 30988028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19376136, 29361788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30892080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34076249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35897813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27998274	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	28600982	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depression, single episode	Mental Depression	BEFREE	30191781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31639552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	23166610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12866036, 16704985, 22703186, 25241037, 27102200, 27916422, 28988825, 29566941, 29930100, 31046734, 31154462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31040369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31066170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26442469, 29436167, 31702508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28803067, 31451071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30244973, 31547300, 31657115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26365176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17089023, 19884383, 23792589, 24186207, 28453464, 31064849, 31594836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30684287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12866036, 22285815, 23208510, 25585584, 27102200, 27916422, 28453464, 29436167, 29629336, 29654866, 29789344, 29888964, 29930100, 30015870, 30400212 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14670614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12866036, 15254719, 16704985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29930100		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23416000, 26387540, 28452072, 28991225, 29665239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23477830	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29665239, 31461993, 37277330, 37758066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	BEFREE	19297390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21630437, 30191781		★★★★★ ★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	Myoclonic epilepsy with ragged red fibers	Pubtator	35922766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	16474966, 21756203, 22285815, 27388218, 28279226, 28864016, 29186342, 31690633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	17563058, 22848045, 28346099, 28864016, 33946753, 36292779, 37171500, 37679383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	17907962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28346099, 32867330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15649578, 16122961, 16216916, 23250358, 23449621, 29765501, 30342783, 30512225, 31678594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18182465, 22077634	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18332166, 19061896, 19297390, 24290359, 25961951, 27998274, 29288336, 29888964, 31081111, 31480724, 32377739, 32452827, 32947930, 33019842, 33268822 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	19297390, 19859975, 22834844, 31292108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	Pubtator	19297390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial encephalopathy	Mitochondrial encephalopathy	BEFREE	27179217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	17551003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	31266022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31215835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24402435, 25695395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23073717, 25492529, 28483651, 30669473, 31704454, 31718280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25492529, 35008743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30063300	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31704454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	22319435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	30462217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31180336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	19808358, 22503866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	22503866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	28302481, 29325933, 30223807, 31133853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31144160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27542888	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28591028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30945396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Native American myopathy	Native American Myopathy	BEFREE	28477081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12866036, 14670614, 15920699, 17089023, 21162720, 23792589, 24403067, 25585584, 28381162, 28978917, 29463573, 30374329, 30391585, 30400212, 30684287 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30982966		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19118529, 22100502		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	LHGDN	19118529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	28474670, 28482072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19118529, 28377712, 28611589, 28946859, 30835941, 31718280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24383721, 25099937, 33804860, 37679383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25492529	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17081970, 18090434, 20840068, 22589246, 23406886, 23669350, 24383721, 24398293, 25753246, 29334584, 29438738, 29502862, 29580918, 30236862, 30664159 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	23900073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17704301, 17999673, 18588668, 20890895, 23269818, 23602251, 25003952, 26356709, 27658772, 30572788, 30785444, 31843573		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28803067, 30880247, 31713888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30518830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	11916956, 12565902, 14740316, 16213225, 16474966, 17030965, 19077249, 19966034, 21266331, 21325336, 22016516, 23583180, 24258516, 24670271, 25753246 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	14740316, 16403952, 17216277, 18614852, 19077249, 19966034, 21817823, 22106445, 22253914, 23269818, 23583180, 25923461, 26185753, 26386696, 27699582 View all (9 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21190973, 24141239, 28824327	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25370852, 25975200	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	21904299, 30138744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	21904299, 30138744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	28761019, 29735636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	36134662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37935325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33149812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30017591, 30075123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30017591, 30075123, 31691358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30075123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17341490, 31097683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17341490, 31097683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30244973, 31547300, 31657115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27271583, 31657115, 33294122, 33802591, 33921111, 35577908, 36012230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26365176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30221360, 30570131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19374590, 20840068, 20926834, 21215313, 21595954, 22100502, 22589246, 23939409, 24145959, 25363075, 25853296, 28403913, 28407521, 28611284, 28611589 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	19374590, 21215313, 21595954, 23939409, 24290359, 24582596, 28972555, 29630901, 29986767, 30934776, 31930701, 32452827, 32591623, 33804860	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	30236862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24204994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31307745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	31307745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	25009290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	25009290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28694700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28993480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16600233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17563058, 19681917, 20130411, 27889100, 29030253, 30993568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17563058	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27889100, 38131196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31290266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	19273754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23354620, 24293610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17089023, 19884383, 23792589, 24186207, 28453464, 31064849, 31594836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19884383, 28453464, 32377739, 33230156, 33934205, 37061917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31594836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22973467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	22973467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17459894, 22815389, 34831227, 38320732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40655182	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31473487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31028741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31066170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26119730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29216750, 29344670, 29913155, 31447676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23141926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	27998274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	23141926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19070258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	19070258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	31862890, 38320732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23348010, 26663532, 30722794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23348010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	26683626	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	36735267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	19273754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21454555, 28974562, 29887956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35692078	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31361024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32801084, 36037136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28978917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27079936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20529956, 20890895, 27015186, 27658772, 28540526, 29057935, 29167529, 29882814, 30871963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30684287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36587194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	30578580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19297390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	17581637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	20368732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27494611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27494611, 30069928, 34167437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	25340339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	29424256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36114448	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30556158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	38012555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26191154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27312223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	19077249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28502800, 29057950, 31037127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPARGC1A (PPARG coactivator 1 alpha)