Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5465
Gene name	Peroxisome proliferator activated receptor alpha
Gene symbol	PPARA
Synonyms (NCBI Gene)	NR1C1PPARPPAR-alphaPPARalphahPPAR
Chromosome	22
Chromosome location	22q13.31
Summary	Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800206	C>G	Risk-factor	Coding sequence variant, non coding transcript variant, missense variant, synonymous variant

860

Show/Hide all (860)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002473	hsa-miR-22-3p	Western blot	18347104
MIRT002473	hsa-miR-22-3p	Luciferase reporter assay	19011694
MIRT002473	hsa-miR-22-3p	qRT-PCRLuciferase reporter assayWestern blot	19011694
MIRT000630	hsa-miR-519d-3p	Luciferase reporter assayqRT-PCRWestern blot	20057369
MIRT005068	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	19780876
MIRT005068	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	19780876
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	FlowImmunoprecipitaionIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21636785
MIRT006422	hsa-miR-21-5p	FlowImmunoprecipitaionIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21636785
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	Luciferase reporter assay	21636785
MIRT006422	hsa-miR-21-5p	FlowImmunoprecipitaionIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21636785
MIRT006422	hsa-miR-21-5p	FlowImmunoprecipitaionIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	21636785
MIRT006709	hsa-miR-141-3p	Luciferase reporter assayqRT-PCRWestern blot	22479552
MIRT017974	hsa-miR-335-5p	Microarray	18185580
MIRT022715	hsa-miR-124-3p	Microarray	18668037
MIRT006422	hsa-miR-21-5p	Microarray	18591254
MIRT053098	hsa-miR-9-5p	Luciferase reporter assay	23525285
MIRT053098	hsa-miR-9-5p	Luciferase reporter assay	23525285
MIRT006422	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24012640
MIRT006422	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24012640
MIRT054795	hsa-miR-548d-5p	Luciferase reporter assayQRTPCRWestern blotting	24929254
MIRT437434	hsa-miR-33a-5p	qRT-PCRWestern blot	24100264
MIRT438762	hsa-miR-130a-3p	Luciferase reporter assay	24960162
MIRT438762	hsa-miR-130a-3p	Luciferase reporter assay	24960162
MIRT438762	hsa-miR-130a-3p	Luciferase reporter assay	24960162
MIRT438762	hsa-miR-130a-3p	Luciferase reporter assay	24960162
MIRT640606	hsa-miR-5692a	HITS-CLIP	23824327
MIRT640605	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT640604	hsa-miR-3671	HITS-CLIP	23824327
MIRT640603	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT640602	hsa-miR-607	HITS-CLIP	23824327
MIRT640601	hsa-miR-1305	HITS-CLIP	23824327
MIRT640600	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT454336	hsa-miR-4779	PAR-CLIP	23592263
MIRT454335	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT454334	hsa-miR-4459	PAR-CLIP	23592263
MIRT454332	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT454333	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT454331	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT454330	hsa-miR-3689d	PAR-CLIP	23592263
MIRT454329	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT454328	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT454327	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT454326	hsa-miR-8085	PAR-CLIP	23592263
MIRT454325	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT454324	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT454322	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT454323	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT454321	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT454319	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT445026	hsa-miR-4426	PAR-CLIP	22100165
MIRT445025	hsa-miR-4647	PAR-CLIP	22100165
MIRT445024	hsa-miR-4662b	PAR-CLIP	22100165
MIRT445023	hsa-miR-4699-5p	PAR-CLIP	22100165
MIRT445022	hsa-miR-27a-5p	PAR-CLIP	22100165
MIRT158798	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT158799	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT734827	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	26330104
MIRT006422	hsa-miR-21-5p	qRT-PCRWestern blot	26338827
MIRT005958	hsa-miR-130b-3p	qRT-PCRWestern blot	26475357
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay	27364335
MIRT445022	hsa-miR-27a-5p	Luciferase reporter assayWestern blot	27910957
MIRT445022	hsa-miR-27a-5p	Luciferase reporter assayWestern blot	27910957
MIRT640601	hsa-miR-1305	HITS-CLIP	27418678
MIRT640605	hsa-miR-130b-5p	HITS-CLIP	27418678
MIRT640600	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT640604	hsa-miR-3671	HITS-CLIP	27418678
MIRT640603	hsa-miR-4753-3p	HITS-CLIP	27418678
MIRT640606	hsa-miR-5692a	HITS-CLIP	27418678
MIRT734827	hsa-miR-34a-5p	qRT-PCR	31885789
MIRT736822	hsa-miR-21-3p	Western blottingqRT-PCR	33733575
MIRT736822	hsa-miR-21-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32628541
MIRT640606	hsa-miR-5692a	HITS-CLIP	23824327
MIRT640605	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT640604	hsa-miR-3671	HITS-CLIP	23824327
MIRT640603	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT640602	hsa-miR-607	HITS-CLIP	23824327
MIRT640601	hsa-miR-1305	HITS-CLIP	23824327
MIRT640600	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT615379	hsa-miR-6756-5p	HITS-CLIP	23824327
MIRT615378	hsa-miR-6766-5p	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT609983	hsa-miR-4651	HITS-CLIP	23824327
MIRT609982	hsa-miR-608	HITS-CLIP	23824327
MIRT609981	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT206051	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT609980	hsa-miR-6089	HITS-CLIP	23824327
MIRT454336	hsa-miR-4779	PAR-CLIP	23592263
MIRT454335	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT454334	hsa-miR-4459	PAR-CLIP	23592263
MIRT454332	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT454333	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT454331	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT454330	hsa-miR-3689d	PAR-CLIP	23592263
MIRT454329	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT454328	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT454327	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT454326	hsa-miR-8085	PAR-CLIP	23592263
MIRT454325	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT454324	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT454322	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT454323	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT454321	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT454319	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT445026	hsa-miR-4426	PAR-CLIP	22100165
MIRT445025	hsa-miR-4647	PAR-CLIP	22100165
MIRT445024	hsa-miR-4662b	PAR-CLIP	22100165
MIRT445023	hsa-miR-4699-5p	PAR-CLIP	22100165
MIRT445022	hsa-miR-27a-5p	PAR-CLIP	22100165
MIRT006422	hsa-miR-21-5p	Luciferase reporter assayWestern blottingqRT-PCR	38189395
MIRT006422	hsa-miR-21-5p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)	35159062
MIRT1251504	hsa-let-7a	CLIP-seq
MIRT1251505	hsa-let-7b	CLIP-seq
MIRT1251506	hsa-let-7c	CLIP-seq
MIRT1251507	hsa-let-7d	CLIP-seq
MIRT1251508	hsa-let-7e	CLIP-seq
MIRT1251509	hsa-let-7f	CLIP-seq
MIRT1251510	hsa-let-7g	CLIP-seq
MIRT1251511	hsa-let-7i	CLIP-seq
MIRT1251512	hsa-miR-103a	CLIP-seq
MIRT1251513	hsa-miR-106a	CLIP-seq
MIRT1251514	hsa-miR-106b	CLIP-seq
MIRT1251515	hsa-miR-107	CLIP-seq
MIRT1251516	hsa-miR-1193	CLIP-seq
MIRT1251517	hsa-miR-1207-3p	CLIP-seq
MIRT1251518	hsa-miR-1254	CLIP-seq
MIRT1251519	hsa-miR-1270	CLIP-seq
MIRT1251520	hsa-miR-136	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT1251522	hsa-miR-15a	CLIP-seq
MIRT1251523	hsa-miR-15b	CLIP-seq
MIRT1251524	hsa-miR-16	CLIP-seq
MIRT1251525	hsa-miR-17	CLIP-seq
MIRT1251526	hsa-miR-185	CLIP-seq
MIRT1251527	hsa-miR-1909	CLIP-seq
MIRT1251528	hsa-miR-195	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT1251530	hsa-miR-202	CLIP-seq
MIRT1251531	hsa-miR-2053	CLIP-seq
MIRT1251532	hsa-miR-20a	CLIP-seq
MIRT1251533	hsa-miR-20b	CLIP-seq
MIRT1251534	hsa-miR-219-5p	CLIP-seq
MIRT1251535	hsa-miR-2392	CLIP-seq
MIRT1251536	hsa-miR-2861	CLIP-seq
MIRT1251537	hsa-miR-302a	CLIP-seq
MIRT1251538	hsa-miR-302b	CLIP-seq
MIRT1251539	hsa-miR-302c	CLIP-seq
MIRT1251540	hsa-miR-302d	CLIP-seq
MIRT1251541	hsa-miR-302e	CLIP-seq
MIRT1251542	hsa-miR-3116	CLIP-seq
MIRT1251543	hsa-miR-3136-3p	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251545	hsa-miR-3157-5p	CLIP-seq
MIRT1251546	hsa-miR-3164	CLIP-seq
MIRT1251547	hsa-miR-3165	CLIP-seq
MIRT1251548	hsa-miR-3187-3p	CLIP-seq
MIRT1251549	hsa-miR-3190	CLIP-seq
MIRT1251550	hsa-miR-3605-5p	CLIP-seq
MIRT1251551	hsa-miR-3646	CLIP-seq
MIRT1251552	hsa-miR-3672	CLIP-seq
MIRT1251553	hsa-miR-370	CLIP-seq
MIRT1251554	hsa-miR-372	CLIP-seq
MIRT1251555	hsa-miR-373	CLIP-seq
MIRT1251556	hsa-miR-3918	CLIP-seq
MIRT1251557	hsa-miR-3920	CLIP-seq
MIRT1251558	hsa-miR-3921	CLIP-seq
MIRT1251559	hsa-miR-3942-3p	CLIP-seq
MIRT1251560	hsa-miR-411	CLIP-seq
MIRT1251561	hsa-miR-424	CLIP-seq
MIRT1251562	hsa-miR-4282	CLIP-seq
MIRT1251563	hsa-miR-4293	CLIP-seq
MIRT1251564	hsa-miR-4306	CLIP-seq
MIRT1251565	hsa-miR-4435	CLIP-seq
MIRT1251566	hsa-miR-4445	CLIP-seq
MIRT1251567	hsa-miR-4456	CLIP-seq
MIRT1251568	hsa-miR-4458	CLIP-seq
MIRT1251569	hsa-miR-4477a	CLIP-seq
MIRT1251570	hsa-miR-4500	CLIP-seq
MIRT1251571	hsa-miR-4512	CLIP-seq
MIRT1251572	hsa-miR-4531	CLIP-seq
MIRT1251573	hsa-miR-4644	CLIP-seq
MIRT1251574	hsa-miR-4653-5p	CLIP-seq
MIRT1251575	hsa-miR-4663	CLIP-seq
MIRT1251576	hsa-miR-4670-3p	CLIP-seq
MIRT1251577	hsa-miR-4678	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT1251579	hsa-miR-4716-5p	CLIP-seq
MIRT1251580	hsa-miR-4731-5p	CLIP-seq
MIRT1251581	hsa-miR-4747-5p	CLIP-seq
MIRT1251582	hsa-miR-4765	CLIP-seq
MIRT1251583	hsa-miR-4766-5p	CLIP-seq
MIRT1251584	hsa-miR-4781-3p	CLIP-seq
MIRT1251585	hsa-miR-4782-3p	CLIP-seq
MIRT1251586	hsa-miR-497	CLIP-seq
MIRT1251587	hsa-miR-508-3p	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT1251589	hsa-miR-511	CLIP-seq
MIRT1251590	hsa-miR-512-3p	CLIP-seq
MIRT1251591	hsa-miR-514	CLIP-seq
MIRT1251592	hsa-miR-514b-3p	CLIP-seq
MIRT1251593	hsa-miR-515-5p	CLIP-seq
MIRT1251594	hsa-miR-519d	CLIP-seq
MIRT1251595	hsa-miR-520a-3p	CLIP-seq
MIRT1251596	hsa-miR-520b	CLIP-seq
MIRT1251597	hsa-miR-520c-3p	CLIP-seq
MIRT1251598	hsa-miR-520d-3p	CLIP-seq
MIRT1251599	hsa-miR-520e	CLIP-seq
MIRT1251600	hsa-miR-544b	CLIP-seq
MIRT1251601	hsa-miR-548aa	CLIP-seq
MIRT1251602	hsa-miR-548c-3p	CLIP-seq
MIRT1251603	hsa-miR-548s	CLIP-seq
MIRT1251604	hsa-miR-548t	CLIP-seq
MIRT1251605	hsa-miR-550a	CLIP-seq
MIRT1251606	hsa-miR-556-5p	CLIP-seq
MIRT1251607	hsa-miR-570	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT1251609	hsa-miR-617	CLIP-seq
MIRT1251610	hsa-miR-620	CLIP-seq
MIRT1251611	hsa-miR-642b	CLIP-seq
MIRT1251612	hsa-miR-653	CLIP-seq
MIRT1251613	hsa-miR-661	CLIP-seq
MIRT1251614	hsa-miR-665	CLIP-seq
MIRT1251615	hsa-miR-720	CLIP-seq
MIRT1251616	hsa-miR-93	CLIP-seq
MIRT1251617	hsa-miR-942	CLIP-seq
MIRT1251618	hsa-miR-98	CLIP-seq
MIRT1251504	hsa-let-7a	CLIP-seq
MIRT1251505	hsa-let-7b	CLIP-seq
MIRT1251506	hsa-let-7c	CLIP-seq
MIRT1251507	hsa-let-7d	CLIP-seq
MIRT1251508	hsa-let-7e	CLIP-seq
MIRT1251509	hsa-let-7f	CLIP-seq
MIRT1251510	hsa-let-7g	CLIP-seq
MIRT1251511	hsa-let-7i	CLIP-seq
MIRT1251619	hsa-miR-1	CLIP-seq
MIRT1251620	hsa-miR-101	CLIP-seq
MIRT1251512	hsa-miR-103a	CLIP-seq
MIRT1251513	hsa-miR-106a	CLIP-seq
MIRT1251514	hsa-miR-106b	CLIP-seq
MIRT1251515	hsa-miR-107	CLIP-seq
MIRT1251621	hsa-miR-1200	CLIP-seq
MIRT1251622	hsa-miR-1205	CLIP-seq
MIRT1251517	hsa-miR-1207-3p	CLIP-seq
MIRT1251623	hsa-miR-1208	CLIP-seq
MIRT1251624	hsa-miR-1224-3p	CLIP-seq
MIRT1251625	hsa-miR-1224-5p	CLIP-seq
MIRT1251626	hsa-miR-1253	CLIP-seq
MIRT1251518	hsa-miR-1254	CLIP-seq
MIRT1251627	hsa-miR-1258	CLIP-seq
MIRT1251628	hsa-miR-1260	CLIP-seq
MIRT1251629	hsa-miR-1260b	CLIP-seq
MIRT1251630	hsa-miR-1261	CLIP-seq
MIRT1251631	hsa-miR-1267	CLIP-seq
MIRT1251632	hsa-miR-1273f	CLIP-seq
MIRT1251633	hsa-miR-1280	CLIP-seq
MIRT1251634	hsa-miR-1286	CLIP-seq
MIRT1251635	hsa-miR-1304	CLIP-seq
MIRT1251636	hsa-miR-1321	CLIP-seq
MIRT1251520	hsa-miR-136	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT1251637	hsa-miR-140-3p	CLIP-seq
MIRT1251638	hsa-miR-142-5p	CLIP-seq
MIRT1251639	hsa-miR-144	CLIP-seq
MIRT1251522	hsa-miR-15a	CLIP-seq
MIRT1251523	hsa-miR-15b	CLIP-seq
MIRT1251524	hsa-miR-16	CLIP-seq
MIRT1251525	hsa-miR-17	CLIP-seq
MIRT1251640	hsa-miR-181a	CLIP-seq
MIRT1251641	hsa-miR-181b	CLIP-seq
MIRT1251642	hsa-miR-181c	CLIP-seq
MIRT1251643	hsa-miR-181d	CLIP-seq
MIRT1251527	hsa-miR-1909	CLIP-seq
MIRT1251644	hsa-miR-1910	CLIP-seq
MIRT1251528	hsa-miR-195	CLIP-seq
MIRT1251645	hsa-miR-19a	CLIP-seq
MIRT1251646	hsa-miR-19b	CLIP-seq
MIRT1251530	hsa-miR-202	CLIP-seq
MIRT1251647	hsa-miR-2052	CLIP-seq
MIRT1251648	hsa-miR-206	CLIP-seq
MIRT1251649	hsa-miR-208a	CLIP-seq
MIRT1251650	hsa-miR-208b	CLIP-seq
MIRT1251532	hsa-miR-20a	CLIP-seq
MIRT1251533	hsa-miR-20b	CLIP-seq
MIRT1251651	hsa-miR-2113	CLIP-seq
MIRT1251652	hsa-miR-218	CLIP-seq
MIRT1251653	hsa-miR-2467-3p	CLIP-seq
MIRT1251536	hsa-miR-2861	CLIP-seq
MIRT1251654	hsa-miR-298	CLIP-seq
MIRT1251655	hsa-miR-31	CLIP-seq
MIRT1251542	hsa-miR-3116	CLIP-seq
MIRT1251543	hsa-miR-3136-3p	CLIP-seq
MIRT1251656	hsa-miR-3145-3p	CLIP-seq
MIRT1251657	hsa-miR-3147	CLIP-seq
MIRT1251658	hsa-miR-3150b-3p	CLIP-seq
MIRT1251659	hsa-miR-3158-5p	CLIP-seq
MIRT1251660	hsa-miR-3160-3p	CLIP-seq
MIRT1251661	hsa-miR-3160-5p	CLIP-seq
MIRT1251547	hsa-miR-3165	CLIP-seq
MIRT1251662	hsa-miR-3183	CLIP-seq
MIRT1251663	hsa-miR-3184	CLIP-seq
MIRT1251549	hsa-miR-3190	CLIP-seq
MIRT1251664	hsa-miR-3194-3p	CLIP-seq
MIRT1251665	hsa-miR-3201	CLIP-seq
MIRT1251666	hsa-miR-340	CLIP-seq
MIRT1251667	hsa-miR-3609	CLIP-seq
MIRT1251668	hsa-miR-3617	CLIP-seq
MIRT1251669	hsa-miR-3652	CLIP-seq
MIRT1251670	hsa-miR-3658	CLIP-seq
MIRT1251671	hsa-miR-3664-5p	CLIP-seq
MIRT1251672	hsa-miR-3673	CLIP-seq
MIRT1251673	hsa-miR-3678-3p	CLIP-seq
MIRT1251674	hsa-miR-3692	CLIP-seq
MIRT1251553	hsa-miR-370	CLIP-seq
MIRT1251675	hsa-miR-382	CLIP-seq
MIRT1251676	hsa-miR-3914	CLIP-seq
MIRT1251556	hsa-miR-3918	CLIP-seq
MIRT1251558	hsa-miR-3921	CLIP-seq
MIRT1251677	hsa-miR-3940-5p	CLIP-seq
MIRT1251559	hsa-miR-3942-3p	CLIP-seq
MIRT1251678	hsa-miR-409-5p	CLIP-seq
MIRT1251679	hsa-miR-412	CLIP-seq
MIRT1251680	hsa-miR-423-5p	CLIP-seq
MIRT1251561	hsa-miR-424	CLIP-seq
MIRT1251681	hsa-miR-4262	CLIP-seq
MIRT1251682	hsa-miR-4265	CLIP-seq
MIRT1251683	hsa-miR-4270	CLIP-seq
MIRT1251684	hsa-miR-4277	CLIP-seq
MIRT1251562	hsa-miR-4282	CLIP-seq
MIRT1251685	hsa-miR-4296	CLIP-seq
MIRT1251686	hsa-miR-4300	CLIP-seq
MIRT1251687	hsa-miR-4302	CLIP-seq
MIRT1251688	hsa-miR-4305	CLIP-seq
MIRT1251689	hsa-miR-4322	CLIP-seq
MIRT1251690	hsa-miR-4324	CLIP-seq
MIRT1251691	hsa-miR-4417	CLIP-seq
MIRT1251692	hsa-miR-4430	CLIP-seq
MIRT1251693	hsa-miR-4434	CLIP-seq
MIRT1251694	hsa-miR-4441	CLIP-seq
MIRT1251567	hsa-miR-4456	CLIP-seq
MIRT1251568	hsa-miR-4458	CLIP-seq
MIRT1251695	hsa-miR-448	CLIP-seq
MIRT1251696	hsa-miR-4493	CLIP-seq
MIRT1251697	hsa-miR-4494	CLIP-seq
MIRT1251570	hsa-miR-4500	CLIP-seq
MIRT1251698	hsa-miR-4507	CLIP-seq
MIRT1251571	hsa-miR-4512	CLIP-seq
MIRT1251699	hsa-miR-4516	CLIP-seq
MIRT1251700	hsa-miR-4521	CLIP-seq
MIRT1251572	hsa-miR-4531	CLIP-seq
MIRT1251701	hsa-miR-4536	CLIP-seq
MIRT1251574	hsa-miR-4653-5p	CLIP-seq
MIRT1251702	hsa-miR-4662a-5p	CLIP-seq
MIRT1251575	hsa-miR-4663	CLIP-seq
MIRT1251703	hsa-miR-4668-3p	CLIP-seq
MIRT1251577	hsa-miR-4678	CLIP-seq
MIRT1251704	hsa-miR-4687-3p	CLIP-seq
MIRT1251705	hsa-miR-4688	CLIP-seq
MIRT1251706	hsa-miR-4689	CLIP-seq
MIRT1251707	hsa-miR-4709-3p	CLIP-seq
MIRT1251708	hsa-miR-4710	CLIP-seq
MIRT1251709	hsa-miR-4717-5p	CLIP-seq
MIRT1251710	hsa-miR-4722-5p	CLIP-seq
MIRT1251711	hsa-miR-4723-3p	CLIP-seq
MIRT1251712	hsa-miR-4739	CLIP-seq
MIRT1251713	hsa-miR-4751	CLIP-seq
MIRT1251714	hsa-miR-4753-5p	CLIP-seq
MIRT1251715	hsa-miR-4756-5p	CLIP-seq
MIRT1251716	hsa-miR-4768-3p	CLIP-seq
MIRT1251717	hsa-miR-4781-5p	CLIP-seq
MIRT1251718	hsa-miR-4784	CLIP-seq
MIRT1251719	hsa-miR-4786-5p	CLIP-seq
MIRT1251720	hsa-miR-4791	CLIP-seq
MIRT1251721	hsa-miR-4792	CLIP-seq
MIRT1251722	hsa-miR-4796-3p	CLIP-seq
MIRT1251723	hsa-miR-4797-5p	CLIP-seq
MIRT1251724	hsa-miR-4802-3p	CLIP-seq
MIRT1251725	hsa-miR-485-5p	CLIP-seq
MIRT1251726	hsa-miR-488	CLIP-seq
MIRT1251586	hsa-miR-497	CLIP-seq
MIRT1251727	hsa-miR-498	CLIP-seq
MIRT1251728	hsa-miR-499-5p	CLIP-seq
MIRT1251729	hsa-miR-499a-5p	CLIP-seq
MIRT1251589	hsa-miR-511	CLIP-seq
MIRT1251593	hsa-miR-515-5p	CLIP-seq
MIRT1251594	hsa-miR-519d	CLIP-seq
MIRT1251730	hsa-miR-532-3p	CLIP-seq
MIRT1251731	hsa-miR-544	CLIP-seq
MIRT1251600	hsa-miR-544b	CLIP-seq
MIRT1251732	hsa-miR-548ah	CLIP-seq
MIRT1251605	hsa-miR-550a	CLIP-seq
MIRT1251606	hsa-miR-556-5p	CLIP-seq
MIRT1251733	hsa-miR-581	CLIP-seq
MIRT1251734	hsa-miR-582-5p	CLIP-seq
MIRT1251735	hsa-miR-593	CLIP-seq
MIRT1251736	hsa-miR-596	CLIP-seq
MIRT1251737	hsa-miR-600	CLIP-seq
MIRT1251738	hsa-miR-613	CLIP-seq
MIRT1251739	hsa-miR-618	CLIP-seq
MIRT1251740	hsa-miR-622	CLIP-seq
MIRT1251741	hsa-miR-641	CLIP-seq
MIRT1251612	hsa-miR-653	CLIP-seq
MIRT1251613	hsa-miR-661	CLIP-seq
MIRT1251614	hsa-miR-665	CLIP-seq
MIRT1251615	hsa-miR-720	CLIP-seq
MIRT1251742	hsa-miR-758	CLIP-seq
MIRT1251743	hsa-miR-873	CLIP-seq
MIRT1251744	hsa-miR-920	CLIP-seq
MIRT1251616	hsa-miR-93	CLIP-seq
MIRT1251618	hsa-miR-98	CLIP-seq
MIRT1251516	hsa-miR-1193	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT1251535	hsa-miR-2392	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251548	hsa-miR-3187-3p	CLIP-seq
MIRT1251560	hsa-miR-411	CLIP-seq
MIRT1251565	hsa-miR-4435	CLIP-seq
MIRT1922322	hsa-miR-4686	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT1251579	hsa-miR-4716-5p	CLIP-seq
MIRT1251584	hsa-miR-4781-3p	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT1251603	hsa-miR-548s	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT1922323	hsa-miR-628-5p	CLIP-seq
MIRT1922324	hsa-miR-640	CLIP-seq
MIRT2074205	hsa-miR-1184	CLIP-seq
MIRT1251516	hsa-miR-1193	CLIP-seq
MIRT1251621	hsa-miR-1200	CLIP-seq
MIRT2074206	hsa-miR-122	CLIP-seq
MIRT2074207	hsa-miR-1226	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT2074209	hsa-miR-1285	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT1251640	hsa-miR-181a	CLIP-seq
MIRT1251641	hsa-miR-181b	CLIP-seq
MIRT1251642	hsa-miR-181c	CLIP-seq
MIRT1251643	hsa-miR-181d	CLIP-seq
MIRT1251644	hsa-miR-1910	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT2074210	hsa-miR-1976	CLIP-seq
MIRT2074211	hsa-miR-21	CLIP-seq
MIRT1251535	hsa-miR-2392	CLIP-seq
MIRT2074212	hsa-miR-3074-5p	CLIP-seq
MIRT2074213	hsa-miR-3121-5p	CLIP-seq
MIRT2074214	hsa-miR-3135b	CLIP-seq
MIRT2074215	hsa-miR-3140-5p	CLIP-seq
MIRT1251548	hsa-miR-3187-3p	CLIP-seq
MIRT2074216	hsa-miR-3187-5p	CLIP-seq
MIRT2074217	hsa-miR-323b-3p	CLIP-seq
MIRT2074218	hsa-miR-331-3p	CLIP-seq
MIRT1251551	hsa-miR-3646	CLIP-seq
MIRT1251670	hsa-miR-3658	CLIP-seq
MIRT1251681	hsa-miR-4262	CLIP-seq
MIRT2074219	hsa-miR-4292	CLIP-seq
MIRT2074220	hsa-miR-4308	CLIP-seq
MIRT1251690	hsa-miR-4324	CLIP-seq
MIRT2074221	hsa-miR-4418	CLIP-seq
MIRT2074222	hsa-miR-4427	CLIP-seq
MIRT1251565	hsa-miR-4435	CLIP-seq
MIRT2074223	hsa-miR-4437	CLIP-seq
MIRT1251567	hsa-miR-4456	CLIP-seq
MIRT2074224	hsa-miR-4476	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT1251702	hsa-miR-4662a-5p	CLIP-seq
MIRT2074226	hsa-miR-4674	CLIP-seq
MIRT2074227	hsa-miR-4680-3p	CLIP-seq
MIRT1922322	hsa-miR-4686	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT2074228	hsa-miR-4707-3p	CLIP-seq
MIRT1251579	hsa-miR-4716-5p	CLIP-seq
MIRT2074229	hsa-miR-4733-3p	CLIP-seq
MIRT2074230	hsa-miR-4735-5p	CLIP-seq
MIRT2074231	hsa-miR-4762-3p	CLIP-seq
MIRT2074232	hsa-miR-4769-3p	CLIP-seq
MIRT2074233	hsa-miR-4775	CLIP-seq
MIRT1251584	hsa-miR-4781-3p	CLIP-seq
MIRT1251723	hsa-miR-4797-5p	CLIP-seq
MIRT2074234	hsa-miR-493	CLIP-seq
MIRT2074235	hsa-miR-509-3-5p	CLIP-seq
MIRT2074236	hsa-miR-509-5p	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT2074237	hsa-miR-513a-3p	CLIP-seq
MIRT2074238	hsa-miR-516a-3p	CLIP-seq
MIRT1251600	hsa-miR-544b	CLIP-seq
MIRT1251603	hsa-miR-548s	CLIP-seq
MIRT1251605	hsa-miR-550a	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT2074239	hsa-miR-590-3p	CLIP-seq
MIRT2074240	hsa-miR-590-5p	CLIP-seq
MIRT2074241	hsa-miR-599	CLIP-seq
MIRT2074242	hsa-miR-612	CLIP-seq
MIRT1922323	hsa-miR-628-5p	CLIP-seq
MIRT1922324	hsa-miR-640	CLIP-seq
MIRT2074243	hsa-miR-888	CLIP-seq
MIRT2074244	hsa-miR-941	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT1251619	hsa-miR-1	CLIP-seq
MIRT1251513	hsa-miR-106a	CLIP-seq
MIRT1251514	hsa-miR-106b	CLIP-seq
MIRT2301180	hsa-miR-1178	CLIP-seq
MIRT2301181	hsa-miR-1182	CLIP-seq
MIRT2074205	hsa-miR-1184	CLIP-seq
MIRT2301182	hsa-miR-1207-5p	CLIP-seq
MIRT1251623	hsa-miR-1208	CLIP-seq
MIRT2074206	hsa-miR-122	CLIP-seq
MIRT1251624	hsa-miR-1224-3p	CLIP-seq
MIRT2074207	hsa-miR-1226	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT2301183	hsa-miR-1234	CLIP-seq
MIRT2301184	hsa-miR-1245	CLIP-seq
MIRT1251626	hsa-miR-1253	CLIP-seq
MIRT2301185	hsa-miR-1257	CLIP-seq
MIRT2301186	hsa-miR-125a-3p	CLIP-seq
MIRT1251628	hsa-miR-1260	CLIP-seq
MIRT1251629	hsa-miR-1260b	CLIP-seq
MIRT2301187	hsa-miR-1265	CLIP-seq
MIRT1251633	hsa-miR-1280	CLIP-seq
MIRT2301188	hsa-miR-1324	CLIP-seq
MIRT2301189	hsa-miR-1343	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT2301190	hsa-miR-141	CLIP-seq
MIRT2301191	hsa-miR-142-3p	CLIP-seq
MIRT2301192	hsa-miR-150	CLIP-seq
MIRT1251525	hsa-miR-17	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT2074210	hsa-miR-1976	CLIP-seq
MIRT2301193	hsa-miR-200a	CLIP-seq
MIRT1251648	hsa-miR-206	CLIP-seq
MIRT1251532	hsa-miR-20a	CLIP-seq
MIRT1251533	hsa-miR-20b	CLIP-seq
MIRT2301194	hsa-miR-2278	CLIP-seq
MIRT1251535	hsa-miR-2392	CLIP-seq
MIRT2301195	hsa-miR-297	CLIP-seq
MIRT1251537	hsa-miR-302a	CLIP-seq
MIRT1251538	hsa-miR-302b	CLIP-seq
MIRT1251539	hsa-miR-302c	CLIP-seq
MIRT1251540	hsa-miR-302d	CLIP-seq
MIRT1251541	hsa-miR-302e	CLIP-seq
MIRT1251655	hsa-miR-31	CLIP-seq
MIRT2074214	hsa-miR-3135b	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251658	hsa-miR-3150b-3p	CLIP-seq
MIRT1251547	hsa-miR-3165	CLIP-seq
MIRT2301196	hsa-miR-3180-5p	CLIP-seq
MIRT1251549	hsa-miR-3190	CLIP-seq
MIRT2301197	hsa-miR-3613-5p	CLIP-seq
MIRT2301198	hsa-miR-3614-5p	CLIP-seq
MIRT1251669	hsa-miR-3652	CLIP-seq
MIRT2301199	hsa-miR-3663-5p	CLIP-seq
MIRT1251671	hsa-miR-3664-5p	CLIP-seq
MIRT1251672	hsa-miR-3673	CLIP-seq
MIRT2301200	hsa-miR-3674	CLIP-seq
MIRT2301201	hsa-miR-371-5p	CLIP-seq
MIRT1251554	hsa-miR-372	CLIP-seq
MIRT1251555	hsa-miR-373	CLIP-seq
MIRT2301202	hsa-miR-378g	CLIP-seq
MIRT2301203	hsa-miR-3927	CLIP-seq
MIRT2301204	hsa-miR-3934	CLIP-seq
MIRT2301205	hsa-miR-4279	CLIP-seq
MIRT2074221	hsa-miR-4418	CLIP-seq
MIRT2074222	hsa-miR-4427	CLIP-seq
MIRT1251692	hsa-miR-4430	CLIP-seq
MIRT2074223	hsa-miR-4437	CLIP-seq
MIRT2301206	hsa-miR-4438	CLIP-seq
MIRT1251567	hsa-miR-4456	CLIP-seq
MIRT2301207	hsa-miR-4470	CLIP-seq
MIRT2301208	hsa-miR-4473	CLIP-seq
MIRT2301209	hsa-miR-4514	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT2301210	hsa-miR-4642	CLIP-seq
MIRT1251575	hsa-miR-4663	CLIP-seq
MIRT2074226	hsa-miR-4674	CLIP-seq
MIRT2074227	hsa-miR-4680-3p	CLIP-seq
MIRT1922322	hsa-miR-4686	CLIP-seq
MIRT2301211	hsa-miR-4690-5p	CLIP-seq
MIRT2301212	hsa-miR-4692	CLIP-seq
MIRT2301213	hsa-miR-4696	CLIP-seq
MIRT2301214	hsa-miR-4698	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT1251707	hsa-miR-4709-3p	CLIP-seq
MIRT1251708	hsa-miR-4710	CLIP-seq
MIRT2301215	hsa-miR-4711-5p	CLIP-seq
MIRT2301216	hsa-miR-4715-3p	CLIP-seq
MIRT2301217	hsa-miR-4722-3p	CLIP-seq
MIRT1251580	hsa-miR-4731-5p	CLIP-seq
MIRT2074229	hsa-miR-4733-3p	CLIP-seq
MIRT2301218	hsa-miR-4736	CLIP-seq
MIRT2301219	hsa-miR-4740-3p	CLIP-seq
MIRT2074231	hsa-miR-4762-3p	CLIP-seq
MIRT2301220	hsa-miR-4763-3p	CLIP-seq
MIRT1251717	hsa-miR-4781-5p	CLIP-seq
MIRT1251718	hsa-miR-4784	CLIP-seq
MIRT2301221	hsa-miR-4790-3p	CLIP-seq
MIRT1251721	hsa-miR-4792	CLIP-seq
MIRT1251727	hsa-miR-498	CLIP-seq
MIRT2074235	hsa-miR-509-3-5p	CLIP-seq
MIRT2301222	hsa-miR-5095	CLIP-seq
MIRT2074236	hsa-miR-509-5p	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT1251590	hsa-miR-512-3p	CLIP-seq
MIRT1251594	hsa-miR-519d	CLIP-seq
MIRT1251595	hsa-miR-520a-3p	CLIP-seq
MIRT2301223	hsa-miR-520a-5p	CLIP-seq
MIRT1251596	hsa-miR-520b	CLIP-seq
MIRT1251597	hsa-miR-520c-3p	CLIP-seq
MIRT1251598	hsa-miR-520d-3p	CLIP-seq
MIRT1251599	hsa-miR-520e	CLIP-seq
MIRT2301224	hsa-miR-520f	CLIP-seq
MIRT2301225	hsa-miR-520g	CLIP-seq
MIRT2301226	hsa-miR-520h	CLIP-seq
MIRT2301227	hsa-miR-525-5p	CLIP-seq
MIRT1251730	hsa-miR-532-3p	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT1251738	hsa-miR-613	CLIP-seq
MIRT1251739	hsa-miR-618	CLIP-seq
MIRT1251740	hsa-miR-622	CLIP-seq
MIRT2301228	hsa-miR-626	CLIP-seq
MIRT2301229	hsa-miR-639	CLIP-seq
MIRT2301230	hsa-miR-647	CLIP-seq
MIRT2301231	hsa-miR-651	CLIP-seq
MIRT1251615	hsa-miR-720	CLIP-seq
MIRT2301232	hsa-miR-764	CLIP-seq
MIRT2301233	hsa-miR-767-5p	CLIP-seq
MIRT2074243	hsa-miR-888	CLIP-seq
MIRT1251616	hsa-miR-93	CLIP-seq
MIRT1251619	hsa-miR-1	CLIP-seq
MIRT1251517	hsa-miR-1207-3p	CLIP-seq
MIRT1251624	hsa-miR-1224-3p	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT2301183	hsa-miR-1234	CLIP-seq
MIRT2301184	hsa-miR-1245	CLIP-seq
MIRT1251628	hsa-miR-1260	CLIP-seq
MIRT1251629	hsa-miR-1260b	CLIP-seq
MIRT2301187	hsa-miR-1265	CLIP-seq
MIRT1251633	hsa-miR-1280	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT2301192	hsa-miR-150	CLIP-seq
MIRT2074210	hsa-miR-1976	CLIP-seq
MIRT1251648	hsa-miR-206	CLIP-seq
MIRT1251649	hsa-miR-208a	CLIP-seq
MIRT1251650	hsa-miR-208b	CLIP-seq
MIRT1251535	hsa-miR-2392	CLIP-seq
MIRT1251547	hsa-miR-3165	CLIP-seq
MIRT1251549	hsa-miR-3190	CLIP-seq
MIRT2301198	hsa-miR-3614-5p	CLIP-seq
MIRT1251668	hsa-miR-3617	CLIP-seq
MIRT1251669	hsa-miR-3652	CLIP-seq
MIRT1251670	hsa-miR-3658	CLIP-seq
MIRT2301199	hsa-miR-3663-5p	CLIP-seq
MIRT1251671	hsa-miR-3664-5p	CLIP-seq
MIRT1251672	hsa-miR-3673	CLIP-seq
MIRT1251692	hsa-miR-4430	CLIP-seq
MIRT2301206	hsa-miR-4438	CLIP-seq
MIRT1251567	hsa-miR-4456	CLIP-seq
MIRT2392865	hsa-miR-4505	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT2074227	hsa-miR-4680-3p	CLIP-seq
MIRT1251578	hsa-miR-4701-5p	CLIP-seq
MIRT1251708	hsa-miR-4710	CLIP-seq
MIRT2301216	hsa-miR-4715-3p	CLIP-seq
MIRT1251579	hsa-miR-4716-5p	CLIP-seq
MIRT2301217	hsa-miR-4722-3p	CLIP-seq
MIRT2074230	hsa-miR-4735-5p	CLIP-seq
MIRT2074233	hsa-miR-4775	CLIP-seq
MIRT1251721	hsa-miR-4792	CLIP-seq
MIRT1251723	hsa-miR-4797-5p	CLIP-seq
MIRT1251728	hsa-miR-499-5p	CLIP-seq
MIRT2301222	hsa-miR-5095	CLIP-seq
MIRT1251730	hsa-miR-532-3p	CLIP-seq
MIRT1251608	hsa-miR-588	CLIP-seq
MIRT2074239	hsa-miR-590-3p	CLIP-seq
MIRT1251738	hsa-miR-613	CLIP-seq
MIRT1251739	hsa-miR-618	CLIP-seq
MIRT1251741	hsa-miR-641	CLIP-seq
MIRT2301230	hsa-miR-647	CLIP-seq
MIRT2301231	hsa-miR-651	CLIP-seq
MIRT1251615	hsa-miR-720	CLIP-seq
MIRT2074244	hsa-miR-941	CLIP-seq
MIRT2074207	hsa-miR-1226	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251668	hsa-miR-3617	CLIP-seq
MIRT1251560	hsa-miR-411	CLIP-seq
MIRT2301206	hsa-miR-4438	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT2456984	hsa-miR-4653-3p	CLIP-seq
MIRT1251707	hsa-miR-4709-3p	CLIP-seq
MIRT2301216	hsa-miR-4715-3p	CLIP-seq
MIRT2074229	hsa-miR-4733-3p	CLIP-seq
MIRT2074230	hsa-miR-4735-5p	CLIP-seq
MIRT2074233	hsa-miR-4775	CLIP-seq
MIRT1251723	hsa-miR-4797-5p	CLIP-seq
MIRT2301222	hsa-miR-5095	CLIP-seq
MIRT2456985	hsa-miR-548a-3p	CLIP-seq
MIRT2456986	hsa-miR-548e	CLIP-seq
MIRT2456987	hsa-miR-548f	CLIP-seq
MIRT2074239	hsa-miR-590-3p	CLIP-seq
MIRT1251741	hsa-miR-641	CLIP-seq
MIRT2074244	hsa-miR-941	CLIP-seq
MIRT1251619	hsa-miR-1	CLIP-seq
MIRT2074205	hsa-miR-1184	CLIP-seq
MIRT2074206	hsa-miR-122	CLIP-seq
MIRT1251624	hsa-miR-1224-3p	CLIP-seq
MIRT2074207	hsa-miR-1226	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT2301184	hsa-miR-1245	CLIP-seq
MIRT1251628	hsa-miR-1260	CLIP-seq
MIRT1251629	hsa-miR-1260b	CLIP-seq
MIRT2597818	hsa-miR-1273g	CLIP-seq
MIRT1251633	hsa-miR-1280	CLIP-seq
MIRT2301189	hsa-miR-1343	CLIP-seq
MIRT1251521	hsa-miR-138	CLIP-seq
MIRT2597819	hsa-miR-1914	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT2074210	hsa-miR-1976	CLIP-seq
MIRT1251648	hsa-miR-206	CLIP-seq
MIRT2074214	hsa-miR-3135b	CLIP-seq
MIRT2597820	hsa-miR-3138	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251661	hsa-miR-3160-5p	CLIP-seq
MIRT2597821	hsa-miR-33a	CLIP-seq
MIRT2597822	hsa-miR-33b	CLIP-seq
MIRT1251669	hsa-miR-3652	CLIP-seq
MIRT2301199	hsa-miR-3663-5p	CLIP-seq
MIRT1251672	hsa-miR-3673	CLIP-seq
MIRT2301202	hsa-miR-378g	CLIP-seq
MIRT2597823	hsa-miR-3908	CLIP-seq
MIRT1251677	hsa-miR-3940-5p	CLIP-seq
MIRT1251560	hsa-miR-411	CLIP-seq
MIRT2301205	hsa-miR-4279	CLIP-seq
MIRT2074219	hsa-miR-4292	CLIP-seq
MIRT2074220	hsa-miR-4308	CLIP-seq
MIRT2074221	hsa-miR-4418	CLIP-seq
MIRT2597824	hsa-miR-4422	CLIP-seq
MIRT1251692	hsa-miR-4430	CLIP-seq
MIRT2074223	hsa-miR-4437	CLIP-seq
MIRT2301206	hsa-miR-4438	CLIP-seq
MIRT1251698	hsa-miR-4507	CLIP-seq
MIRT2597825	hsa-miR-4509	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT2597826	hsa-miR-4643	CLIP-seq
MIRT2074226	hsa-miR-4674	CLIP-seq
MIRT2597827	hsa-miR-4690-3p	CLIP-seq
MIRT1251707	hsa-miR-4709-3p	CLIP-seq
MIRT1251708	hsa-miR-4710	CLIP-seq
MIRT2301216	hsa-miR-4715-3p	CLIP-seq
MIRT2301217	hsa-miR-4722-3p	CLIP-seq
MIRT2074229	hsa-miR-4733-3p	CLIP-seq
MIRT2074230	hsa-miR-4735-5p	CLIP-seq
MIRT2597828	hsa-miR-4744	CLIP-seq
MIRT2074233	hsa-miR-4775	CLIP-seq
MIRT1251721	hsa-miR-4792	CLIP-seq
MIRT2597829	hsa-miR-4800-5p	CLIP-seq
MIRT1251727	hsa-miR-498	CLIP-seq
MIRT2074235	hsa-miR-509-3-5p	CLIP-seq
MIRT2301222	hsa-miR-5095	CLIP-seq
MIRT2074236	hsa-miR-509-5p	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT2301223	hsa-miR-520a-5p	CLIP-seq
MIRT2301227	hsa-miR-525-5p	CLIP-seq
MIRT1251730	hsa-miR-532-3p	CLIP-seq
MIRT1251731	hsa-miR-544	CLIP-seq
MIRT1251605	hsa-miR-550a	CLIP-seq
MIRT2074239	hsa-miR-590-3p	CLIP-seq
MIRT1251738	hsa-miR-613	CLIP-seq
MIRT1251611	hsa-miR-642b	CLIP-seq
MIRT2074244	hsa-miR-941	CLIP-seq
MIRT2074206	hsa-miR-122	CLIP-seq
MIRT1251624	hsa-miR-1224-3p	CLIP-seq
MIRT2074207	hsa-miR-1226	CLIP-seq
MIRT2074208	hsa-miR-1227	CLIP-seq
MIRT1251628	hsa-miR-1260	CLIP-seq
MIRT1251629	hsa-miR-1260b	CLIP-seq
MIRT1251633	hsa-miR-1280	CLIP-seq
MIRT2301189	hsa-miR-1343	CLIP-seq
MIRT1251529	hsa-miR-197	CLIP-seq
MIRT2688399	hsa-miR-1972	CLIP-seq
MIRT2074214	hsa-miR-3135b	CLIP-seq
MIRT1251544	hsa-miR-3149	CLIP-seq
MIRT1251669	hsa-miR-3652	CLIP-seq
MIRT1251560	hsa-miR-411	CLIP-seq
MIRT2074219	hsa-miR-4292	CLIP-seq
MIRT2074220	hsa-miR-4308	CLIP-seq
MIRT2688400	hsa-miR-4424	CLIP-seq
MIRT1251692	hsa-miR-4430	CLIP-seq
MIRT2301206	hsa-miR-4438	CLIP-seq
MIRT2074225	hsa-miR-455-5p	CLIP-seq
MIRT2597826	hsa-miR-4643	CLIP-seq
MIRT2688401	hsa-miR-4650-5p	CLIP-seq
MIRT2597827	hsa-miR-4690-3p	CLIP-seq
MIRT1251707	hsa-miR-4709-3p	CLIP-seq
MIRT2301215	hsa-miR-4711-5p	CLIP-seq
MIRT2301216	hsa-miR-4715-3p	CLIP-seq
MIRT2074229	hsa-miR-4733-3p	CLIP-seq
MIRT2074230	hsa-miR-4735-5p	CLIP-seq
MIRT2074233	hsa-miR-4775	CLIP-seq
MIRT1251727	hsa-miR-498	CLIP-seq
MIRT2301222	hsa-miR-5095	CLIP-seq
MIRT1251588	hsa-miR-5096	CLIP-seq
MIRT2301223	hsa-miR-520a-5p	CLIP-seq
MIRT2301227	hsa-miR-525-5p	CLIP-seq
MIRT1251730	hsa-miR-532-3p	CLIP-seq
MIRT1251605	hsa-miR-550a	CLIP-seq
MIRT2074239	hsa-miR-590-3p	CLIP-seq
MIRT1251611	hsa-miR-642b	CLIP-seq
MIRT2074244	hsa-miR-941	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
CREBBP	Unknown	10542237
HIF1A	Unknown	14521756
HNF4A	Unknown	11981036
JUN	Unknown	10542237
NR2F2	Unknown	11981036
RELA	Unknown	10542237
STAT1	Activation	24242046
STAT3	Activation	24242046
TP63	Unknown	19458633

116

Show/Hide all (116)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9748239, 12700342
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9748239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	26983400
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	9748239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9748239
GO:0001666	Process	Response to hypoxia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10860941
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19955185
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003707	Function	Nuclear steroid receptor activity	IDA	19955185
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	12955147, 19955185
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	9653119, 11915042, 15722453, 16554032, 19955185, 21775429, 24043310, 24713062, 25814554, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12955147
GO:0005634	Component	Nucleus	IDA	24639097
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16271724
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0007507	Process	Heart development	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007595	Process	Lactation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IDA	12955147
GO:0008289	Function	Lipid binding	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	ISS
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010565	Process	Regulation of ketone metabolic process	IDA	19955185
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	12700342, 19114110
GO:0010887	Process	Negative regulation of cholesterol storage	IBA
GO:0010887	Process	Negative regulation of cholesterol storage	IDA	19114110
GO:0019217	Process	Regulation of fatty acid metabolic process	IDA	19955185
GO:0019902	Function	Phosphatase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	31611175
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IEA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IPI	19955185
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	TAS	16271724
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0032099	Process	Negative regulation of appetite	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035095	Process	Behavioral response to nicotine	IEA
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IDA	12955147
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	ISS
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045820	Process	Negative regulation of glycolytic process	IDA	19955185
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12955147
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9748239, 19955185, 20837115
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046209	Process	Nitric oxide metabolic process	IEA
GO:0046321	Process	Positive regulation of fatty acid oxidation	IEA
GO:0046321	Process	Positive regulation of fatty acid oxidation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	25592151
GO:0048511	Process	Rhythmic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21636785
GO:0051525	Function	NFAT protein binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	31574452
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19955185
GO:0070166	Process	Enamel mineralization	IEA
GO:0071332	Process	Cellular response to fructose stimulus	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0097371	Function	MDM2/MDM4 family protein binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IMP	31574452
GO:1902894	Process	Negative regulation of miRNA transcription	IDA	21636785
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IDA	21636785
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IMP	31574452
GO:1903944	Process	Negative regulation of hepatocyte apoptotic process	IMP	31574452
GO:1904189	Process	Positive regulation of transformation of host cell by virus	IMP	22479552
GO:2000191	Process	Regulation of fatty acid transport	TAS	16271724
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IMP	31574452

MIM	HGNC	e!Ensembl
170998	9232	ENSG00000186951

Q07869

Protein name

Peroxisome proliferator-activated receptor alpha (PPAR-alpha) (Nuclear receptor subfamily 1 group C member 1)

Protein function

Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regu

PDB

1I7G , 1K7L , 1KKQ , 2NPA , 2P54 , 2REW , 2ZNN , 3ET1 , 3FEI , 3G8I , 3KDT , 3KDU , 3SP6 , 3VI8 , 4BCR , 4CI4 , 5AZT , 5HYK , 6KAX , 6KAY , 6KAZ , 6KB0 , 6KB1 , 6KB2 , 6KB3 , 6KB4 , 6KB5 , 6KB6 , 6KB7 , 6KB8 , 6KB9 , 6KBA , 6KXX , 6KXY , 6KYP , 6L36 , 6L37 , 6L38 , 6L96 , 6LX4 , 6LX5 , 6LX6 , 6LX7 , 6LX8 , 6LX9 , 6LXA , 6LXB , 6LXC , 7BPY , 7BPZ , 7BQ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	100 → 168	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	264 → 449	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Skeletal muscle, liver, heart and kidney. Expressed in monocytes (PubMed:28167758). {ECO:0000269|PubMed:28167758, ECO:0000269|PubMed:7981125, ECO:0000269|PubMed:8993548}.

Sequence

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Sequence length

468

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (54)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperapobetalipoproteinemia, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIAS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPARA-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (429)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abdominal obesity metabolic syndrome	Metabolic Syndrome	CTD_human_DG	15309680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	LHGDN	15811118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	18092840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18855529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20838448, 29659887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	13680532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	CTD_human_DG	19834340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16403907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31354797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27618583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10955810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	18703563, 22447153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult-onset citrullinemia type 2	Citrullinemia	BEFREE	25533124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25109799, 28980001, 29183319, 29628329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21785974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	31217429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19828088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	28346566, 28427149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26080426, 29995422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	11137312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	31217429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	25970251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	26460070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	37426638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	27483138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25630951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	19497962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	23354045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	31735914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10431661, 10542237, 10855543, 11914252, 12377786, 15199365, 15578089, 15994444, 16239970, 17261671, 17888025, 17909121, 18541586, 19220285, 21474829 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	40534874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22231457, 23546972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29547450, 31744213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22713245, 28590769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	28601889	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10377075, 11852057, 11934839, 12785728, 17492134, 21911782, 23717417, 26098621, 30697628, 35791925, 36142760, 9748221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10431661, 10542237, 10855543, 11914252, 12377786, 15199365, 15578089, 15994444, 16239970, 17261671, 17888025, 17909121, 18541586, 19220285, 21474829 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11861426	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15199365, 18004978		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	24021653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30366038, 30769127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18977277		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30983568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	17405874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29862557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11980898, 27924948, 31772149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11980898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18710415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	18652775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37418975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30660821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20569465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12203367, 15899809, 16326050, 18003597, 18586686, 23061909, 23076161, 23208589, 23372804, 24141935, 27906043, 28669518, 29435026, 31775380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12379472, 15318936, 18586686, 23372804, 25120762, 25291031, 26621841, 31775380, 33277843, 33634680, 34493366, 35370244, 35686034, 35692496, 36096037, 36304471, 36424525, 36867680 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22205725, 23821302, 26206264, 31752829, 33390794, 40304310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26556865	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	11137312		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12203367, 16609007, 29197930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	32628541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11897617, 15963265, 18381945, 19119483, 20110263, 22168458, 22930530, 25024626, 26380295, 27757837, 30176945, 30428868, 31480990, 32626741, 33436534 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11980898, 27924948, 31772149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20081051, 23625588, 25043640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23951092, 30486822, 30616081, 32712616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34446056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	11137312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12594240, 25329697, 27629528, 28279226, 30592062, 30745182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	14675851	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37542511, 39294340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16307905	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	14675851, 16307905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16307905, 31249632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12544661, 17194889, 17360982, 17363837, 17608467, 18034623, 18173954, 18336366, 18586686, 19776627, 19822141, 23858092, 26098621, 28157411, 29222605 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17363837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17363837, 18586686, 22309242, 26098621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21393601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	21458577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	20454521, 27483138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30697628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	14625020, 18652775		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15863131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15863131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	16540796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	23830897, 29112762, 29498526, 30928103, 30964181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	30964181, 35196362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31602208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16115480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27496805, 28760335, 30890453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23160450, 25825462, 26070013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20807714, 28708015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	BEFREE	29859326		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28521669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29995422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19617644, 29483924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	22662201	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22662201, 33132321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10357777, 16378595, 31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27565680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15177943, 16343055, 18648741, 19283612, 27816970, 31354797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16343055, 19283612, 22036718, 23679280, 30985693, 34791641, 35974387, 38212126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16185925, 16307905, 16371224, 18998207, 20103776, 21430558, 22333581, 27629528, 28011586, 28158412, 28578382, 29093735, 29272013, 29301869, 31577975, 31602208 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23951092, 29866440, 30486822, 31258735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29445990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10855543, 11914252, 18336366, 18855529, 20838448, 27512842, 30562729, 31305657		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10855543, 11914252, 16043164, 18336366, 27512842, 28415751, 30562729, 30564122, 31305657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	16043164, 17342071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21911782, 30369316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10855543, 11119019, 11914252, 15199365, 18336366, 21833536, 23583468, 27512842, 30562729, 31305657		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	15199365		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21829567		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	30015893	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21829567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21829567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16875506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16875506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	16875506	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11840453, 30248539, 30729704, 30945071, 31285188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	20640553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29722018, 31445056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	18249437, 23947677, 29111315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11886504, 33683743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	18092840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	17181634		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	18092840, 18249437, 23947677, 24530874, 29111315, 29353040		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	18092840, 22509831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11119019, 15592662, 15677519, 15739197, 17157013, 17194889, 17317762, 17475934, 18230892, 19805902, 19866471, 20420754, 20838448, 23147557, 23512374 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11119019, 15592662, 15677519, 15739197, 16221474, 17157013, 17194889, 17317762, 17475934, 18191967, 18230892, 19805902, 19866471, 20420754, 20838448 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11852057, 12594295, 18078524, 20838448, 21443859, 21911782, 31864032, 32968798, 35477946, 36142760, 36360783, 36997916, 37522815, 39596398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15199365, 16221474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18586686, 20346437, 21911782, 22309242, 24359475, 27483138, 30110382, 31974142, 35791925, 36142760, 36445944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15500444, 30716067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10634806, 10777704, 10828087, 10855543, 11119019, 11289057, 11409711, 11793024, 11928067, 12145174, 12610044, 12835617, 15192440, 15199365, 15592662 View all (43 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17184146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	17317762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28011586, 28013071, 29659121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24371263, 38174742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26849944, 27224243, 27543085, 28521876, 31063766, 31585912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	11928067, 26671228, 28270521, 28979999, 29628329, 30716067, 30912953, 31451517, 31771164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25997411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	23907334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31226981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30658033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	10828087, 10855543, 11928067, 15199365, 15801817, 16107159, 17129741, 17550777, 17604218, 17608467, 17904533, 19088257, 19646654, 19683050, 20825652 View all (22 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	CTD_human_DG	16168052		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	LHGDN	17998026, 18388689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	18292238, 20825652, 21533120, 23919842, 24460649, 26621841, 28835163, 30110382, 35227068, 36142760	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	15199365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	12955147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18092840, 18249437, 23947677, 24530874, 29111315, 29353040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31299417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	30272268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22205725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37305395	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11443174, 15136115, 30556891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30954274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34329340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28980001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30578827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	16371224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	16297361, 20692331, 20709644, 21474829, 23112047, 23318274, 24456360, 24814977, 24926685, 25312970, 25605057, 25896250, 25991671, 26323321, 28111231 View all (19 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	LHGDN	18853997		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	19124612		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	19733654, 24534255, 25533124, 29018509, 29391755, 31243135, 39458470	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	16297361, 21474829, 23603006, 24864249, 25703085, 27998724, 28195199, 28218651, 28406477, 29093267, 29164820, 30206765, 30248539, 30551380, 30579258 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	CTD_human_DG	18703563		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	24456360, 28131861, 30567368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	27930988, 30818137, 31367862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	31847785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	28096081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15177567, 19671747, 22446686, 22732497, 26172294, 27736000, 27835866, 27926792, 29312541, 30565681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15456533, 22732497, 25566967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29862267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15177567, 19671747, 22446686, 22732497, 23284888, 26172294, 27736000, 27835866, 27926792, 29312541, 30565681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20378009, 20569465, 29862267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27835866, 30565681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27835866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31312364, 31402171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	36147466	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38174742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	38174742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	28919422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28980001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28594934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	14675851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	14675851, 22606221, 27391067, 31407515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16185925, 16307905, 16371224, 18998207, 21430558, 22333581, 27629528, 28011586, 28158412, 28578382, 29093735, 29272013, 31577975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16185925, 16307905, 21430558, 32154187, 37950149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16371224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	31004117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26735218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32507013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29764933, 9921653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31752829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hibernoma	Hibernoma	BEFREE	21078971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	29222092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	28096081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30341732, 31237119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16731822, 20825652, 21725906, 28111985, 28759754, 30029727, 30404040, 31398873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	21533120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30789748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11334419, 19376972, 31547433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17888025, 18191967, 19866471, 20026355, 21725906, 21823058, 22447153, 26305715, 27100490, 28084058, 28157411, 28366492, 28404815, 28646549, 29111315 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	CTD_human_DG	21640707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10828087, 12468272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	12468272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	17363837, 33682762	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	BEFREE	10828087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	CTD_human_DG	10828087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	16371224	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11864924, 15202783, 17909121, 27881385, 28289017, 29222605, 29315078		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	11864924		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	16054168, 19834340		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	29626530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	20057369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	16371224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	21968942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	CTD_human_DG	16777972		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	17478558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22932900	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23372804, 30475063, 36429023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33046043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21829567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23160450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29995422, 30898012, 31299417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	20884859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17610002, 22662201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29483924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	18249437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17184146, 19733654, 20825652, 23907334, 34646087	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21443859	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21701566	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36814575, 36841375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31325449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	16927143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	27628953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	31833409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23512374, 26671025, 26679678, 30697628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	16316343		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	17888025, 25825462, 29278547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	31611175, 32628541	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	13680532, 31733829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	16115480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	17998026		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19878707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	23951092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11864924, 16371224, 22333581		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32621919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21305029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32621919, 34549887, 35395550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	31759407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichen planus follicularis	Lichen planopilaris	BEFREE	29333153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27816970, 28453233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	12042669, 16239165, 26334901, 28777810, 30398974, 30562729, 30709407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	17270403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12554753, 16216487, 18381945, 19119483, 21514001, 22168458, 23141142, 23168409, 26206264, 26282231, 26333042, 27194100, 27618583, 27757837, 28565872 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17331954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25024626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	25024626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36139455, 37759496	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39840890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	23891824, 32507013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	25165883, 27010852, 28600667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12554753, 16216487, 23168409, 25092647, 28267557, 29197930, 29626562, 30629241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	20143881, 29134746		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	27757837	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	29547450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33046043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20081051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23867003, 25514196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29436615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	21325597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16403907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32631374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12203367, 15899809, 16326050, 18003597, 18586686, 23061909, 23076161, 23208589, 23372804, 24141935, 27906043, 28669518, 29435026, 31775380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	20143881, 29134746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22168458, 25991671, 29197930, 30697791, 9924174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20081051, 23625588, 25043640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27816970, 28453233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29059162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10955810, 12897377, 20466759, 28072703, 28483457, 31769890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	22919386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29142602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11980898, 27924948, 31772149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12729718, 17893092, 19723884, 20510503, 25327562, 26556865, 27736000, 27918085, 28182091, 28334197, 28594934, 29301506, 30594433, 30739829, 31215667, 31436750, 31539552, 31636510 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	17405874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15863131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16378595, 31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28287408, 29956189, 30660623, 31676441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12203367, 15318936, 16226051, 18586686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	11355020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18546270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16707598, 18092840, 18172578, 28483457, 31175545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18172578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	20685720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20685720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29722018, 31445056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11928067, 26334901, 27145114, 27863018, 28185575, 28279226, 28374976, 28404815, 28990606, 29224415, 29318455, 29681858, 29849537, 29895749, 30020428 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	16511589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26334901, 34471048, 36139455, 37286039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19416532, 19639232, 26673968, 30827999, 35216509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24060638	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11289057, 15309680, 17608467, 18191967, 21877956, 21968942, 24060638, 24373239, 26083812, 26673968, 27009398, 27898587, 28406477, 29315078, 29363671 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19639232, 23894440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	30278189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26999671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16484546, 18977277, 28483651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35929063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18336366, 28771799, 29222605, 29272013		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	19217440		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11914252, 18855529, 20838448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	18855529, 20838448, 27391067	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	27884680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	19683050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	CTD_human_DG	19683050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	30521668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20838448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16271155	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31467515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10955810, 11980898, 12707035, 16239970, 16343055, 17473186, 18092840, 18199835, 19283612, 20081051, 21326871, 22932900, 23208589, 23906790, 23951092 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	17405874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30565681		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30157453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17390299, 23821302, 26092426, 26887049, 27860527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23821302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28521669, 30273550, 30759808, 31273781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17671740, 18853997, 18949388, 20825652, 23318274, 23603006, 23891820, 23891824, 24864249, 24926685, 25312970, 25450203, 25661699, 25703085, 25896250 View all (33 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23603006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20081051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	16297361, 23603006, 25703085, 27998724, 28098353, 28195199, 30659956, 30850637, 30975991		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23603006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	10440134, 11928067, 12568179, 15739197, 16731822, 17129741, 18212024, 18230892, 18777501, 19646654, 19805902, 20057369, 20444420, 21448362, 21528816 View all (25 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	11089532, 30738174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18586686, 19733654, 20057369, 21190973, 21443859, 22205725, 22278432, 23545576, 25379721, 25670728, 26073637, 27444220, 30428868, 36371454, 37742414, 39596398 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26694359, 37286039	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29454501	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	12148087, 15202783, 31388096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11840453, 21458577, 23546972, 33415161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21765106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24451878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	12544661, 29034841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29059162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15754392, 32367578, 33164330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30639234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28594934, 31272790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	BEFREE	28594934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23500098, 28346830, 30612307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	15531738, 16940242, 27442659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	30021235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	30021235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30021235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28903946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28903946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20130411, 21827375, 22564702, 22729915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31278444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	29929914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30955840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16403907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	20640553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	30100231, 30928103, 31077509, 31312410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29310470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30021235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10955810, 12897377, 20466759, 28072703, 28483457, 31769890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12897377		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20466759, 26429394, 28072703, 31756185, 33031638	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	22919386		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudopelade	Pseudopelade	BEFREE	29333153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11886504, 23965158, 33683743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	15083308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17459894, 40655182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28708015	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	CTD_human_DG	16777972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21829567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23951092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25343824, 27543085, 28871336, 31112599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30736366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28498479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	12594295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30716067, 31771164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19683050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31205465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34745150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scarring alopecia	Alopecia	BEFREE	29333153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11840500, 25087592, 25433960, 27624431, 30461214		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22920733, 25087592, 25433960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25433960	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	29967008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27881386, 30677458		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	26976796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	31740620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19404300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	11886504, 35477946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	23288968	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	31181146, 36748964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	27834148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15811118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17473186, 18092840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29716593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16253638, 16297361, 16393287, 16634986, 19187070, 19207680, 19780876, 19789836, 20692331, 20709644, 20825652, 21474829, 22940187, 23112047, 23603006 View all (46 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	19124612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29142602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23317272	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30880766, 33906066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18652775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	25291031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28709620		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	15291748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30278442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29369787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30058426, 32846846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24529079, 29301506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29301506, 36424525, 38373689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19617644, 22662201, 28223944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	11137312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11980898, 36168624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29436615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29432661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35791925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16371224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Very long chain acyl-CoA dehydrogenase deficiency	Acyl CoA Dehydrogenase Deficiency	BEFREE	30428868		★★★★★ ★☆☆☆☆ Found in Text Mining only
VLCAD deficiency	Very long-chain acyl-coa dehydrogenase deficiency	Pubtator	33549744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPARA (peroxisome proliferator activated receptor alpha)