POTEKP (POTE ankyrin domain family member K, pseudogene)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 440915
• Gene name: POTE ankyrin domain family member K, pseudogene
• Gene symbol: POTEKP
• Synonyms (NCBI Gene): ACT, ACTBL3, POTE2delta, POTEK
• Chromosome: 2
• Chromosome location: 2q21.1

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0007409	Process	Axonogenesis	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	IBA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030424	Component	Axon	IBA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IBA
GO:0045202	Component	Synapse	IBA
GO:0048870	Process	Cell motility	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098973	Function	Structural constituent of postsynaptic actin cytoskeleton	IBA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEA

Other IDs

• MIM: 611266
• HGNC: 30182
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BYX7
• Protein name: Putative beta-actin-like protein 3 (Kappa-actin) (POTE ankyrin domain family member K)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00022	Actin	2 → 375	Actin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in some hepatocellular carcinomas. {ECO:0000269|PubMed:16824795}.
• Sequence:

  MDDDTAVLVIDNGSGMCKAGFAGDDAPQAVFPSIVGRPRHQGMMEGMHQKESYVGKEAQS
  KRGMLTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT
  QIMFETFNTPAMYVAIQAVLSLYTSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDL
  AGRELTDYLMKILTERGYRFTTTAEQEIVRDIKEKLCYVALDSEQEMAMAASSSSVEKSY
  ELPDGQVITIGNERFRCPEALFQPCFLGMESCGIHKTTFNSIVKSDVDIRKDLYTNTVLS
  GGTTMYPGIAHRMQKEITALAPSIMKIKIIAPPKRKYSVWVGGSILASLSTFQQMWISKQ
  EYDESGPSIVHRKCF

• Sequence length: 375

Related Genes

No strongly related genes found yet for POTEKP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to POTEKP.