Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	728378
Gene name	POTE ankyrin domain family member F
Gene symbol	POTEF
Synonyms (NCBI Gene)	A26C1BACTBPOTE2alphaPOTEACTIN
Chromosome	2
Chromosome location	2q21.1

216 Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029171	hsa-miR-26b-5p	Microarray	19088304
MIRT051155	hsa-miR-16-5p	CLASH	23622248
MIRT1250289	hsa-miR-1253	CLIP-seq
MIRT1250290	hsa-miR-1303	CLIP-seq
MIRT1250291	hsa-miR-18a	CLIP-seq
MIRT1250292	hsa-miR-18b	CLIP-seq
MIRT1250293	hsa-miR-216a	CLIP-seq
MIRT1250294	hsa-miR-224	CLIP-seq
MIRT1250295	hsa-miR-3119	CLIP-seq
MIRT1250296	hsa-miR-342-5p	CLIP-seq
MIRT1250297	hsa-miR-3613-3p	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT739855	hsa-miR-3973	CLIP-seq
MIRT1250299	hsa-miR-4251	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT1250301	hsa-miR-4282	CLIP-seq
MIRT1250302	hsa-miR-4325	CLIP-seq
MIRT1250303	hsa-miR-4329	CLIP-seq
MIRT1250304	hsa-miR-4477a	CLIP-seq
MIRT1250305	hsa-miR-4477b	CLIP-seq
MIRT1250306	hsa-miR-4640-5p	CLIP-seq
MIRT1250307	hsa-miR-4651	CLIP-seq
MIRT1250308	hsa-miR-4664-5p	CLIP-seq
MIRT1250309	hsa-miR-4699-5p	CLIP-seq
MIRT1250310	hsa-miR-4726-5p	CLIP-seq
MIRT1250311	hsa-miR-4735-3p	CLIP-seq
MIRT1250312	hsa-miR-4795-5p	CLIP-seq
MIRT739853	hsa-miR-520g	CLIP-seq
MIRT739854	hsa-miR-520h	CLIP-seq
MIRT1250313	hsa-miR-524-3p	CLIP-seq
MIRT1250314	hsa-miR-525-3p	CLIP-seq
MIRT1250315	hsa-miR-570	CLIP-seq
MIRT1250316	hsa-miR-608	CLIP-seq
MIRT739856	hsa-miR-624	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT1250318	hsa-miR-759	CLIP-seq
MIRT1250289	hsa-miR-1253	CLIP-seq
MIRT1552455	hsa-miR-1266	CLIP-seq
MIRT1250290	hsa-miR-1303	CLIP-seq
MIRT1250294	hsa-miR-224	CLIP-seq
MIRT1552456	hsa-miR-3064-5p	CLIP-seq
MIRT1552457	hsa-miR-3169	CLIP-seq
MIRT1552458	hsa-miR-3614-3p	CLIP-seq
MIRT1552459	hsa-miR-3664-3p	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT1250299	hsa-miR-4251	CLIP-seq
MIRT1552460	hsa-miR-4270	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT1250303	hsa-miR-4329	CLIP-seq
MIRT1552461	hsa-miR-4441	CLIP-seq
MIRT1552462	hsa-miR-4515	CLIP-seq
MIRT1552463	hsa-miR-4518	CLIP-seq
MIRT1552464	hsa-miR-4639-3p	CLIP-seq
MIRT1250306	hsa-miR-4640-5p	CLIP-seq
MIRT1552465	hsa-miR-4691-3p	CLIP-seq
MIRT1250310	hsa-miR-4726-5p	CLIP-seq
MIRT1552466	hsa-miR-4786-5p	CLIP-seq
MIRT1552467	hsa-miR-552	CLIP-seq
MIRT1552468	hsa-miR-604	CLIP-seq
MIRT1552469	hsa-miR-647	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT1250318	hsa-miR-759	CLIP-seq
MIRT1552470	hsa-miR-766	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT1250289	hsa-miR-1253	CLIP-seq
MIRT1250290	hsa-miR-1303	CLIP-seq
MIRT2073914	hsa-miR-1321	CLIP-seq
MIRT1250291	hsa-miR-18a	CLIP-seq
MIRT1250292	hsa-miR-18b	CLIP-seq
MIRT2073915	hsa-miR-197	CLIP-seq
MIRT1250293	hsa-miR-216a	CLIP-seq
MIRT1250294	hsa-miR-224	CLIP-seq
MIRT1552456	hsa-miR-3064-5p	CLIP-seq
MIRT1250295	hsa-miR-3119	CLIP-seq
MIRT2073916	hsa-miR-3162-5p	CLIP-seq
MIRT1552457	hsa-miR-3169	CLIP-seq
MIRT2073917	hsa-miR-3187-3p	CLIP-seq
MIRT2073918	hsa-miR-3189-3p	CLIP-seq
MIRT1250296	hsa-miR-342-5p	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT739855	hsa-miR-3973	CLIP-seq
MIRT2073919	hsa-miR-412	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT1250302	hsa-miR-4325	CLIP-seq
MIRT2073920	hsa-miR-4435	CLIP-seq
MIRT1250305	hsa-miR-4477b	CLIP-seq
MIRT1552462	hsa-miR-4515	CLIP-seq
MIRT2073921	hsa-miR-4524	CLIP-seq
MIRT1552464	hsa-miR-4639-3p	CLIP-seq
MIRT1250306	hsa-miR-4640-5p	CLIP-seq
MIRT1250307	hsa-miR-4651	CLIP-seq
MIRT2073922	hsa-miR-4664-3p	CLIP-seq
MIRT1250308	hsa-miR-4664-5p	CLIP-seq
MIRT2073923	hsa-miR-4690-5p	CLIP-seq
MIRT1552465	hsa-miR-4691-3p	CLIP-seq
MIRT2073924	hsa-miR-4691-5p	CLIP-seq
MIRT2073925	hsa-miR-4701-5p	CLIP-seq
MIRT1250310	hsa-miR-4726-5p	CLIP-seq
MIRT1250311	hsa-miR-4735-3p	CLIP-seq
MIRT2073926	hsa-miR-4739	CLIP-seq
MIRT2073927	hsa-miR-4756-5p	CLIP-seq
MIRT1250312	hsa-miR-4795-5p	CLIP-seq
MIRT2073928	hsa-miR-516a-3p	CLIP-seq
MIRT739853	hsa-miR-520g	CLIP-seq
MIRT739854	hsa-miR-520h	CLIP-seq
MIRT2073929	hsa-miR-548s	CLIP-seq
MIRT1552467	hsa-miR-552	CLIP-seq
MIRT1250315	hsa-miR-570	CLIP-seq
MIRT2073930	hsa-miR-588	CLIP-seq
MIRT1552468	hsa-miR-604	CLIP-seq
MIRT1250316	hsa-miR-608	CLIP-seq
MIRT2073931	hsa-miR-626	CLIP-seq
MIRT1552469	hsa-miR-647	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT2073932	hsa-miR-671-3p	CLIP-seq
MIRT1250318	hsa-miR-759	CLIP-seq
MIRT1552470	hsa-miR-766	CLIP-seq
MIRT2300791	hsa-miR-1200	CLIP-seq
MIRT1250289	hsa-miR-1253	CLIP-seq
MIRT1552455	hsa-miR-1266	CLIP-seq
MIRT1250290	hsa-miR-1303	CLIP-seq
MIRT2073914	hsa-miR-1321	CLIP-seq
MIRT2073915	hsa-miR-197	CLIP-seq
MIRT2300792	hsa-miR-205	CLIP-seq
MIRT1250293	hsa-miR-216a	CLIP-seq
MIRT1250294	hsa-miR-224	CLIP-seq
MIRT1552456	hsa-miR-3064-5p	CLIP-seq
MIRT1250295	hsa-miR-3119	CLIP-seq
MIRT2073916	hsa-miR-3162-5p	CLIP-seq
MIRT1552457	hsa-miR-3169	CLIP-seq
MIRT2073917	hsa-miR-3187-3p	CLIP-seq
MIRT2073918	hsa-miR-3189-3p	CLIP-seq
MIRT2300793	hsa-miR-331-3p	CLIP-seq
MIRT1250296	hsa-miR-342-5p	CLIP-seq
MIRT1552458	hsa-miR-3614-3p	CLIP-seq
MIRT1552459	hsa-miR-3664-3p	CLIP-seq
MIRT2300794	hsa-miR-3674	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT739855	hsa-miR-3973	CLIP-seq
MIRT2073919	hsa-miR-412	CLIP-seq
MIRT1552460	hsa-miR-4270	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT2300795	hsa-miR-4324	CLIP-seq
MIRT2073920	hsa-miR-4435	CLIP-seq
MIRT1552461	hsa-miR-4441	CLIP-seq
MIRT1552462	hsa-miR-4515	CLIP-seq
MIRT1552463	hsa-miR-4518	CLIP-seq
MIRT2073921	hsa-miR-4524	CLIP-seq
MIRT1552464	hsa-miR-4639-3p	CLIP-seq
MIRT1250306	hsa-miR-4640-5p	CLIP-seq
MIRT1250307	hsa-miR-4651	CLIP-seq
MIRT2073922	hsa-miR-4664-3p	CLIP-seq
MIRT1250308	hsa-miR-4664-5p	CLIP-seq
MIRT2073923	hsa-miR-4690-5p	CLIP-seq
MIRT1552465	hsa-miR-4691-3p	CLIP-seq
MIRT2073925	hsa-miR-4701-5p	CLIP-seq
MIRT1250310	hsa-miR-4726-5p	CLIP-seq
MIRT2073926	hsa-miR-4739	CLIP-seq
MIRT2073927	hsa-miR-4756-5p	CLIP-seq
MIRT1552466	hsa-miR-4786-5p	CLIP-seq
MIRT1250312	hsa-miR-4795-5p	CLIP-seq
MIRT2300796	hsa-miR-485-3p	CLIP-seq
MIRT739853	hsa-miR-520g	CLIP-seq
MIRT739854	hsa-miR-520h	CLIP-seq
MIRT2300797	hsa-miR-544b	CLIP-seq
MIRT2073929	hsa-miR-548s	CLIP-seq
MIRT1552467	hsa-miR-552	CLIP-seq
MIRT1250315	hsa-miR-570	CLIP-seq
MIRT2073930	hsa-miR-588	CLIP-seq
MIRT1552468	hsa-miR-604	CLIP-seq
MIRT2300798	hsa-miR-605	CLIP-seq
MIRT1250316	hsa-miR-608	CLIP-seq
MIRT2073931	hsa-miR-626	CLIP-seq
MIRT1552469	hsa-miR-647	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT2073932	hsa-miR-671-3p	CLIP-seq
MIRT1250318	hsa-miR-759	CLIP-seq
MIRT1552470	hsa-miR-766	CLIP-seq
MIRT1250291	hsa-miR-18a	CLIP-seq
MIRT1250292	hsa-miR-18b	CLIP-seq
MIRT1250293	hsa-miR-216a	CLIP-seq
MIRT1250294	hsa-miR-224	CLIP-seq
MIRT1552456	hsa-miR-3064-5p	CLIP-seq
MIRT1250298	hsa-miR-3912	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT1250302	hsa-miR-4325	CLIP-seq
MIRT1250305	hsa-miR-4477b	CLIP-seq
MIRT1250311	hsa-miR-4735-3p	CLIP-seq
MIRT1552467	hsa-miR-552	CLIP-seq
MIRT1552468	hsa-miR-604	CLIP-seq
MIRT1552469	hsa-miR-647	CLIP-seq
MIRT1250317	hsa-miR-659	CLIP-seq
MIRT1250318	hsa-miR-759	CLIP-seq
MIRT1250290	hsa-miR-1303	CLIP-seq
MIRT2073914	hsa-miR-1321	CLIP-seq
MIRT1250295	hsa-miR-3119	CLIP-seq
MIRT2073916	hsa-miR-3162-5p	CLIP-seq
MIRT1552457	hsa-miR-3169	CLIP-seq
MIRT1250296	hsa-miR-342-5p	CLIP-seq
MIRT1250300	hsa-miR-4279	CLIP-seq
MIRT1552462	hsa-miR-4515	CLIP-seq
MIRT2073921	hsa-miR-4524	CLIP-seq
MIRT1250306	hsa-miR-4640-5p	CLIP-seq
MIRT1250307	hsa-miR-4651	CLIP-seq
MIRT1250308	hsa-miR-4664-5p	CLIP-seq
MIRT2073923	hsa-miR-4690-5p	CLIP-seq
MIRT1250310	hsa-miR-4726-5p	CLIP-seq
MIRT2073926	hsa-miR-4739	CLIP-seq
MIRT2073927	hsa-miR-4756-5p	CLIP-seq
MIRT1250312	hsa-miR-4795-5p	CLIP-seq
MIRT1250316	hsa-miR-608	CLIP-seq
MIRT1250291	hsa-miR-18a	CLIP-seq
MIRT1250292	hsa-miR-18b	CLIP-seq
MIRT1250305	hsa-miR-4477b	CLIP-seq
MIRT1250311	hsa-miR-4735-3p	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005884	Component	Actin filament	IBA
GO:0005938	Component	Cell cortex	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	IBA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030424	Component	Axon	IBA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IBA
GO:0045202	Component	Synapse	IBA
GO:0048870	Process	Cell motility	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0098973	Function	Structural constituent of postsynaptic actin cytoskeleton	IBA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

A5A3E0

Protein name

POTE ankyrin domain family member F (ANKRD26-like family C member 1B) (Chimeric POTE-actin protein)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00022	Actin	702 → 1075	Actin	Family
PF12796	Ank_2	143 → 236	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	243 → 335	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	280 → 368	Ankyrin repeats (3 copies)	Repeat
PF13857	Ank_5	160 → 213		Repeat
PF14915	CCDC144C	648 → 707	CCDC144C protein coiled-coil region	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in breast cancer cell lines (at protein level). {ECO:0000269|PubMed:17101985}.

Sequence

MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCCRESGKSNVGTSGDHDDSAMKTLRSK
MGKWCRHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSSKSKVGAW
GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKQDKQKRTALHLA
SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN
TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRFKGSENSQPEKMSQEPEINKDGDREVEEEMK
KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE
KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
EMKKHRSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDILHENSTLREEIAMLRL
ELDTMKHQSQLREKKYLEDIESVKKRNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
DMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVL
SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTEHGYRF
TTMAEREIVRDIKEKLCYVALDFEQEMATVASSSSLEKSYELPDGQVITIGNERFRCPEA
LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCL

Sequence length

1075

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (788)
Aarskog syndrome	Aarskog Syndrome	BEFREE	11181572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	28087633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Accessory nipple	Accessory Nipple	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Accessory rib	Accessory Rib	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	15817684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Actin-Accumulation Myopathy	Nemaline myopathy	BEFREE	10508519, 11563546, 15221331, 20621480, 29420541		★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTIVATED PI3K-DELTA SYNDROME	ACTIVATED PI3K-DELTA SYNDROME	BEFREE	31760094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	28663935, 30671311, 7945385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	7949419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10360378, 30213075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23434591, 24721635, 26224645, 28546428, 28623279, 30992323, 31582539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23705901, 27369456, 3468999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29717784, 30653956, 31688596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20111909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adams Oliver syndrome	Adams-Oliver Syndrome	BEFREE	21820096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adams-Oliver syndrome 1	Adams-Oliver Syndrome	BEFREE	21820096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14706854, 16291394, 16979613, 17018615, 19740, 20143334, 23362007, 24867096, 30977161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	1705554, 22790341, 24682235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16291394, 28611465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11162478, 16510572, 23995859, 28002815, 29119966, 29145194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11448913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	9024698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10339655, 11689433, 11691822, 16423286, 17143298, 17293347, 20696638, 28663347, 31471457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	9578504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11410732, 21913943, 28922439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10360378, 30213075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29767447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29967610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29412177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10744042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24297048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	BEFREE	29446713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	9078933		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	6189508		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	6189508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	10838498, 9891469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24628925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	31262562		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMELOGENESIS IMPERFECTA, HYPOPLASTIC/HYPOMATURATION, X-LINKED 1	Amelogenesis Imperfecta, X-Linked	BEFREE	12791319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	26489398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	12071640, 9385928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis, Familial	Amyloidosis	BEFREE	2176164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15020220, 15546588, 19449021, 23063648, 24184715, 25096716, 26499959, 26572741, 28459188, 28466273, 29129529, 31444357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	23063648, 23635659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16257181, 19965636, 23158209, 27751947, 27807861, 30227391, 31072570, 31090208, 31494396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31653238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	20655266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33917969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	31798818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioma	Angioma	BEFREE	19280651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	9630173		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21258211, 22223849, 30808244, 31159419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior subcapsular cataract	Subcapsular cataract	BEFREE	11148599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	22752479, 25861618, 27939432, 30355232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10441523, 24582702, 29087237, 31071332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	21288906, 22753406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	28461455, 29339694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17409670, 23075332, 23689639, 27013612, 27187934, 28677755, 29750899, 30318528, 30529831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17934089, 29550892, 30920392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28255205, 36398072, 37894839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	25886887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	30590815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12200519, 15813808, 16100010, 17302903, 27362794, 30361541, 8970374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12200519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10378372, 12237846, 17597534, 20849807, 24515854, 30259794, 7877454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30259794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	2783578, 6324767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atelosteogenesis, type 1	Atelosteogenesis	BEFREE	19505475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23075332, 23689639, 27013612, 27187934, 28677755, 29750899, 30318528, 30529831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36398072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	25861618, 31430208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	31898838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	27297614		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	16555084, 25195061, 9056541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34948243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23582872, 28870634, 28928363, 29380377, 29885454, 30123108, 30284680, 30771457, 31198525, 31474830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29380377, 30664714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	10406258, 19012040, 27414259, 28690845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17968950, 29904389, 30894852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	19923420		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26774590, 28693230, 29393352, 8467805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Baraitser-Winter cerebrofrontofacial syndrome	Baraitser-Winter Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16291394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	10573008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Nevus Syndrome	Becker Nevus Syndrome	ORPHANET_DG	28347698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker nevus syndrome	Becker Nevus Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Nevus Syndrome	Becker Nevus Syndrome	BEFREE	28625464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Nevus Syndrome	Becker nevus syndrome	Pubtator	32170967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11456109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37335738	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11489810, 29152074, 7525636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	27727313, 27939432, 28102444, 31029755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	27727313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22675524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	22675524	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25113377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11270423, 12187264, 17019707, 2052605, 22843882, 27683119, 29037814, 31369818, 8367495, 9033650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15448745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	BEFREE	23756437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	26028144, 28821556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	36944974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	GENOMICS_ENGLAND_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	28743718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	30928090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	30813947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30325927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12892231, 30877104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	19799649, 21399880, 26934847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10639330, 10970687, 10995872, 11039904, 11555599, 14583477, 15958182, 16326072, 16849564, 17101985, 17363586, 17525277, 17804730, 19544972, 20133759 View all (50 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25617865, 26474971, 31178227, 32358373, 33962648, 34752497, 40133575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22363622, 22773696, 29266319, 29673743, 30463566, 30566624, 31251941		★★★★★ ★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	22948298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap Myopathy	BEFREE	17885449, 22084935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11721445, 15235586, 1719818, 17855511, 18324357, 21062462, 26008973, 27013613, 9255310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17640361, 19200351, 22961449, 29180379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11270423, 17019707, 2052605, 22843882, 27683119, 29037814, 31369818, 8367495, 9033650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11708476, 15048094, 16118410, 19353596, 20682026, 20856855, 21221513, 21468542, 22560902, 22850877, 23342255, 23525486, 25412236, 25885339, 26506240 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18072593, 24885929, 33208882, 33759378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24457517, 34940125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12575847, 27367190, 30534824, 8757754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17926037, 24587343, 27383302, 27840988, 31558772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	15105807, 16731596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	30570870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12075240, 12222827, 16288873, 16845895, 19799913, 27082122, 28513458, 28732641, 28903042, 29878125, 30240712, 30604255, 31130236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	10430757, 10508519, 11052860, 11197556, 11273725, 11563546, 11815424, 15572040, 16845895, 21768101, 22590617, 29440008, 30518548, 30568254, 31038167, 31430208, 7797780, 9563954 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10494087, 10966831, 11140941, 11197556, 11273725, 15572040, 15819894, 16236538, 19222994, 23539503, 23700264, 24088304, 27521604, 29666183, 31038167, 9152850, 9563954 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL RESTRICTIVE, 1 (disorder)	Cardiomyopathy	BEFREE	16288990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	11181629, 29440008, 8898372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16873721, 22798525, 27609643, 27939432, 31002695, 31253938, 31327802, 31481237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31327802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	28135035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	20844585, 22285204, 22410565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	17885449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	19560950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Centronuclear myopathy	Centronuclear Myopathy	BEFREE	28676641, 30601711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy, Hereditary	Cerebral Amyloid Angiopathy	BEFREE	9056541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	25922506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral cortical hemiatrophy	Cerebral cortical hemiatrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29408985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31327802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21248741, 28490769, 29338614, 29844196, 29941816, 30824574, 31131433, 31327802, 31578282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28652363		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27902484, 30230542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27902484, 30230542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	25676889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	29241728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10360378, 11289124, 23328642, 30213075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29412177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17461449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34320944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	2190068, 28189756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	32915926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19375502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorea Acanthocytosis Syndrome	Chorea	BEFREE	22227296, 24080826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	BEFREE	23756766, 29414605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33917969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic intestinal pseudo-obstruction	Intestinal Pseudoobstruction	BEFREE	29749332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30371125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20431038, 24667162, 30371125, 30713579, 31257986, 31623859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18551193, 27534555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11371421, 23299965, 27130881, 29456676, 29514663, 30504086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	BEFREE	28387217, 29799026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	27401686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19815628, 21913943, 30993748, 31709830, 3855390, 9473734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis, Cryptogenic	Cirrhosis	BEFREE	30144554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	29220674		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17530208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	17379343, 26275848, 28688003, 29246925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18005098, 21762661, 31112045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of optic disc	Coloboma of optic disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15538627, 19740, 24105619, 24682235, 26134506, 27878251, 28184026, 29787735, 7287208, 8765974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24682235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	1693276, 25445497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10840940, 18630501, 19724680, 20406101, 22266115, 23752192, 23899558, 24913355, 25167895, 25862911, 26258642, 27399334, 27941874, 28412748, 29573464 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18535985, 22895844, 24682235, 28333953, 32424999, 37124724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	9726090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	15817684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophies	Cone-rod dystrophy	BEFREE	28378834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28378834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	23756437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital aneurysm of ascending aorta	Congenital Aneurysm Of Ascending Aorta	BEFREE	21092924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	30573741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26980027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25189380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	19459883, 26637634, 30792093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	30720141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital euryblepharon	Congenital Euryblepharon	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Fiber Type Disproportion	Congenital myopathy with fiber type disproportion	BEFREE	15468086, 17387733, 29211998, 29338614, 30544720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital fusion of ribs	Rib fusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	10710270, 25861618, 28328125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	27020209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital myopathy (disorder)	Congenital myopathy	BEFREE	10508519, 12921789, 17885449, 18976909, 20452215, 22825594, 23294764, 23656990, 23784376, 25747004, 25978979, 30926871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	CTD_human_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	CTD_human_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	28493397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10966831, 16141380, 16260633, 19246681, 19962384, 20713897, 22590617, 23553616, 25541130, 25935483, 26385185, 26671978, 28341635, 29251807, 30261322, 31072570, 9563954 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	30580688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15596059, 17311301, 18072593, 23416984, 26637866, 28498731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	27922676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19409525, 21248741, 29339694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19409525, 21248741, 24389497, 27187934, 29339694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31886261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10710270, 18067591, 19409525, 21248741, 29339694, 9918849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	24608455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranioschisis	Anencephaly	CTD_human_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	31898838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	31365333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29555578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	28606200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	30893190, 8757754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11316652, 26823603, 28846729, 29871879, 30575422, 8774146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	25255767, 29788902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30498336, 31669118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16555084, 28789972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16555084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Denys-Drash Syndrome	Denys-Drash Syndrome	BEFREE	17295355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17141188, 22995339, 30062729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	29318761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29318761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30147695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	28183315	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29220674, 29274487, 31396261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31898838, 38217996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental malformations-deafness-dystonia syndrome	Developmental Malformations-Deafness-Dystonia Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12206992, 29310936, 31566433, 8603829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11804845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12206992, 28245261, 29310936, 31566433, 8603829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36627346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12372938, 15047636, 20801058, 30039887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31396261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12372938, 15047636, 22056625, 23902294, 27338016, 29033543, 31396261, 31566433, 31704098, 9375822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19320643, 29767447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29642797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Muscular Dystrophies	Distal Muscular Dystrophy	BEFREE	27816332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10328528, 10666669, 10666682, 12499044, 15068247, 15068251, 15176487, 17696169, 23147510, 28839045, 31410926, 31683476, 9918849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12653579, 15535846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	8822112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	25052316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	10411937, 16685646, 22366783, 22495914, 23649928, 23756437, 25052316, 25156961, 27240540, 27868373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysostoses	Dysostoses	CTD_human_DG	16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	29788902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	16685646, 29788902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	30517030		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	28326953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17191257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	34970864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	15054833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Elliptocytosis, Hereditary	Elliptocytosis	BEFREE	2384597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	2282206, 8183732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	7553656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12971625, 21363919, 21715543, 27404958, 27997893, 29615978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	23178314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11779588, 16750201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26354330, 27470151, 31247078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29663427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	14987263, 19120339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	14668478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22119193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	40677923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	24711455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17926037, 24587343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	9630173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	26884827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24777337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17695440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24777337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19243895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29278698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	28835480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	20847418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	1694381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	9056541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial dilated cardiomyopathy	Cardiomyopathy	BEFREE	10966831, 11781950, 11899244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	15940367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28600126, 31709830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17021135, 28203428, 31818892, 7775635, 9596271		★★★★★ ★☆☆☆☆ Found in Text Mining only
fibroma	Fibroma	BEFREE	29940288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7699198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11422610, 22978413, 22989567, 24104560, 27876602, 28104102, 28602220, 28754776, 28822809, 28837849, 29414645, 29538616, 30322375, 30522100, 30766520 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	10700177, 12707390, 18164029, 20023659, 20562105, 21911940, 22832517, 25676889, 27350175, 29038887, 29873512, 31664084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	12707390, 29038887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	22223087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	15703194, 24062571, 25432536, 28688003, 29114037, 29380377, 30771457, 30953439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Freeman-Sheldon syndrome	Freeman-Sheldon Syndrome	BEFREE	30379605		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	23552101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fryns-Aftimos Syndrome	Baraitser-Winter syndrome	BEFREE	22366783, 23649928, 23756437, 25052316, 27862284, 29220674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fryns-Aftimos Syndrome	Baraitser-Winter syndrome	GENOMICS_ENGLAND_DG	22366783, 24896178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28481834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31364740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	12185600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25232253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	21180888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	11095444, 17711922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	11063223, 17090188, 24119563, 29318761, 29592983		★★★★★ ★☆☆☆☆ Found in Text Mining only
gaze palsy familial horizontal with progressive scoliosis	Horizontal gaze palsy with progressive scoliosis	Pubtator	23289769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16218934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29318761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gitelman Syndrome	Gitelman Syndrome	BEFREE	11316245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	20090922, 29278698, 29392327, 29468812, 30807639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23586020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11583578, 12125737, 17182035, 17597534, 24573637, 25682201, 25712375, 27013589, 28679472, 28770500, 28926987, 30654687, 30753211, 30886866, 30897774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22575386, 28498803, 30259794, 39849652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11583578, 12125737, 17182035, 17597534, 24573637, 25419715, 25682201, 27013589, 28679472, 28770500, 28926987, 30654687, 30753211, 30886866, 30897774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12271360, 18294404, 19094064, 21706053, 23201135, 24573110, 25870011, 26846171, 27081897, 27212030, 28380416, 29582423, 7877454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27633570, 29220674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	23983033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	19726546, 29181390, 31222503, 31377057, 9375822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	24297048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11318603, 8327473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	34867951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	30816994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18324357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27856252, 29716942, 30468920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16141380, 16260633, 19246681, 19962384, 20713897, 22590617, 23553616, 25541130, 25935483, 26385185, 26671978, 28341635, 29251807, 31072570, 9563954		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	11854637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	11932989, 16456130, 21689017, 29410238		★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	25431235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18932288	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19586787, 29344147, 30066939, 31638240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	15728360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	16677327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	22150124, 31754310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	BEFREE	30371979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	17431908, 2141669, 3611357, 6215583, 7104494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	23676666		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	14555664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30885557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1774960, 29967610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16968735, 21355047, 30057320, 8240819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25193495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25715248, 27881486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31028566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28077579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	11181629, 20855589, 8327508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	30189026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31327802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20798523, 24201301, 29373038, 30261322, 30291325, 30784931, 31327802, 31694504, 8675693, 9504778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	18837933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	10508519, 10525522, 10966831, 10980884, 11273725, 11563546, 12075240, 12222827, 15819894, 1606666, 16267253, 18572189, 19799913, 22643837, 23700264 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	10508519, 10525522, 10966831, 10980884, 11273725, 11563546, 12075240, 1606666, 19799913, 28119616, 28887330, 29440008, 29719515, 31481237, 7887887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	20709728, 28645175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	15940367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	31898838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	10488052, 31658321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10364451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	12963706, 20204736, 23071643, 28450293, 30659826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15677772, 1862087, 20685750, 22938014, 23434591, 26884454, 28148565, 30230565, 30335500, 30504086, 31644934, 31774302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22015564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	12963706, 19786891		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28685619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30013962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27742059, 30393584, 31773115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17174450, 17379343, 19828813, 26275848, 28688003, 29246925, 29380377, 30423195, 31410926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	28183315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	15198127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile myofibromatosis	myofibromatosis	BEFREE	1739928, 8600777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36369953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20406101, 24859296, 28370348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	29764851, 30431591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10411937, 11050619, 18060736, 23127797, 23582872, 23685357, 23756437, 25480035, 29220674, 29515378, 30256902, 30664714, 30742961, 30953439, 31541143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	23756437, 31898838, 35313204, 38217996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30039887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	31124977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30039887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Atresia Multiple	Multiple intestinal atresia	Pubtator	34970864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34970864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	16611674, 20613766, 28057588, 8875484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30062820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	27521604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	GENOMICS_ENGLAND_DG	10411937, 16685646, 22366783, 24896178, 2505231, 29788902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	CLINVAR_DG	10411937, 25052316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	UNIPROT_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	ORPHANET_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	BEFREE	27633570, 29388391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iris Coloboma with Ptosis, Hypertelorism, and Mental Retardation	Baraitser-Winter Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31327802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31810142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	27629717, 31331814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-onset dystonia	Dystonia	CLINVAR_DG	12325076, 16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-onset dystonia	Dystonia	ORPHANET_DG	16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-onset dystonia	Dystonia	UNIPROT_DG	16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-onset dystonia	Dystonia	GENOMICS_ENGLAND_DG	29788902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-onset dystonia	Dystonia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	19429708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis	Keratoconjunctivitis	BEFREE	15073317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	17200661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	22562506, 24826067	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	22562506, 30809473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15855633, 16525419, 20801058, 23467424, 23902294, 28053698, 29678354, 30213782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28775002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	10322647, 28388547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30371125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Larsen syndrome	Larsen Syndrome	BEFREE	15994868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	29499655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	25299115		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21412072, 28981730, 9664117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lattice corneal dystrophy Type II	Lattice corneal dystrophy	BEFREE	10744159, 15215896, 2157434, 8243656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction	Left ventricular noncompaction	BEFREE	20031619		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21412072, 29318761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	28747229		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11238301, 12757924, 7949419, 8912861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23849470, 6966280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	40338916	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	22150124, 31754310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10360378, 11021751, 23155442, 23328642, 23705901, 25860293, 27369456, 3468999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10744042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	BEFREE	22642214		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	29599317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22972986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb-girdle muscular dystrophy type 2A	Limb-girdle muscular dystrophy	BEFREE	17258832		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21412072, 28981730, 9664117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30287850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	27369456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	BEFREE	23495356, 31585108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	Pubtator	25052316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190901, 10397455, 10507762, 11572764, 11920541, 15538627, 15728360, 15918183, 16628605, 18317805, 18466772, 19200351, 19586787, 21323792, 22935208 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144, 21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19815628, 21913943, 30993748, 31709830, 3855390, 9473734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	3855390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29171033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	34752497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	29888507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	17579091, 30504086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	22015564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	21241464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15251953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	23692979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27802291, 38066059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	31487115, 31663664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12708782, 20014960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12708782, 20014960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12708782, 20014960, 21558139, 30767092, 7841998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29102373, 30207171, 30767092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12708782, 20014960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	11564212, 21128782, 28576630, 30054282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28031525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30892133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22096245, 23266771, 7949419, 8183732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	26498110, 31760094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrothrombocytopenia	Macrothrombocytopenia	BEFREE	26452979, 26879394, 27734030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29696386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29696386	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	23495356, 23583676, 30285101, 31657439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	12401825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20845060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18324357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10639330, 10970687, 10995872, 11039904, 11555599, 14583477, 15958182, 16326072, 16849564, 17101985, 17363586, 17525277, 17804730, 19544972, 20133759 View all (52 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21363919, 27404958, 29615978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24777337, 25205106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31364740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23521319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31754310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11708476, 16118410, 19353596, 20682026, 20856855, 21221513, 21468542, 22560902, 22850877, 23342255, 23525486, 25412236, 25885339, 26506240, 27109616 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	23692979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30287850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27383302, 27840988, 31558772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12138232, 18584046, 21684285, 22110277, 22898637, 23121112, 24359721, 24728183, 25576918, 30092175, 30353690, 30396925, 31358530, 8641471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10440748, 11956481, 12187269, 15948292, 16326072, 18095286, 18371299, 18651557, 18694745, 20441232, 20454608, 21360565, 23575475, 25450398, 25883213 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28534938, 29270876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30535476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30136914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11270423, 17019707, 2052605, 22843882, 27683119, 29037814, 31369818, 8367495, 9033650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10190901, 10505859, 10675236, 11039904, 11790552, 11905808, 12531431, 12943687, 15642175, 16125170, 16687574, 17019707, 17178872, 17351649, 17498553 View all (162 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	22767273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27902484, 30230542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19740, 24105619, 24682235, 26134506, 27878251, 28184026, 29787735, 7287208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15287981, 19544972, 21069453, 22031535, 23129656, 23340433, 25547174, 25799492, 29382783, 29596520, 8223610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17018901, 22150124, 31754310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	31678158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29412177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megacystis microcolon intestinal hypoperistalsis syndrome	Berdon syndrome	BEFREE	24676022, 25998219, 26647307, 27007401, 28292896		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11397121, 11564212, 18848571, 19137261, 19244113, 21992144, 22525428, 24337068, 24625986, 24681666, 25017017, 25225982, 25296750, 27347659, 28095330 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12552078, 1850774, 30643008, 31567589, 32326615, 34940125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	BEFREE	20570288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	27855638, 9375822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10378372, 23036990, 29079997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17141188, 22995339, 30062729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17018287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10411937, 11050619, 18060736		★★★★★ ★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	MERRF Syndrome	BEFREE	29933571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21983934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29684438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	14706854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	27633570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcolon	Microcolon	BEFREE	30430282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcornea	Microcornea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	15577676, 21128782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus Inclusion Disease	BEFREE	27229121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28839045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	29753824, 29933571		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	27862284, 29788902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29589107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17141188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	29888507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	29129529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	30889949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	20970362, 22752479, 24160477, 27128593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	20970362, 24160477, 27128593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	14562112, 19320643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	BEFREE	11390716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31169683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	10411937, 16685646, 22366783, 22495914, 23649928, 23756437, 25052316, 25156961, 27240540, 27868373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	10822234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15023543, 15883412, 22177381, 24651437, 2904292, 29589107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29904389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33795012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38520895	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30587509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MULTISYSTEMIC SMOOTH MUSCLE DYSFUNCTION SYNDROME	Multisystemic Smooth Muscle Dysfunction Syndrome	BEFREE	22790431, 30300893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	11843184, 16716629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular dystrophy congenital, merosin negative	Congenital Muscular Dystrophy	BEFREE	16183658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16183658, 28931764, 29481844, 29981373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	20354175		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10360378, 20354175, 26578796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15448745, 16487179, 1921462, 2904292, 8207976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19246681, 28193608, 28453729, 30425163, 30425165, 30473557, 30818997, 31002695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	15198127, 15367857, 23109048, 24668811, 25913210, 30685713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibromatosis	Myofibromatosis	BEFREE	1739928, 8600777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathies, Nemaline	Myopathy	BEFREE	10508519, 11001821, 11063719, 11166164, 11257471, 11333380, 11731279, 12601110, 14733965, 15138616, 15198992, 15236405, 15336686, 15336687, 15564032 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11001821, 11052860, 15072110, 15198127, 16288873, 16685646, 19181093, 19563543, 20088824, 20621480, 21325027, 22358459, 23294764, 23736297, 25241052 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOSIN STORAGE (disorder)	Myosin storage myopathy	BEFREE	17885449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30275509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	28183315	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia congenita	Pubtator	32170967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	18799475, 29382705, 29749332		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	23160194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxofibroma	Myxofibroma	BEFREE	30568965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15736452, 19602597, 23618874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21052085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck webbing	Neck Webbing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	12736398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10378372, 10505859, 10537319, 11023095, 11300722, 11350900, 11476540, 11721445, 11859201, 11920541, 12193744, 12450793, 12527301, 12575847, 12584304 View all (152 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	20595200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	14712353, 17569780, 19808795, 20595200, 28053698, 28805828, 30356069, 30840958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	29788902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17379343, 24618705, 29380377, 30301754, 30662006, 31527793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	11575845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	10835530, 11809806, 31125589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12454018, 15719172, 16720851, 2019470, 24462599, 25705678, 26475688, 27009842, 27425378, 28604741, 29752871, 30572519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17519504, 21355047, 22573689, 25096716, 25814227, 29016853, 29138281, 30057320, 30986029, 31444357, 31725955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29158550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	11300722, 11809806, 14724586, 16324214, 29715273, 31730023, 9378774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	24860983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	24777424, 25676889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22972986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30993748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-compaction cardiomyopathy	Noncompaction cardiomyopathy	BEFREE	23147248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12101420, 12114432, 19913389, 20837458, 24711139, 24918821, 25373410, 25573171, 25613070, 26238532, 26701724, 28418179, 28423648, 29989053, 30231667, 30504086, 31233187 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	15198992, 15367857, 27997893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10481945, 26343330, 9504854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	13680526, 16385458, 22718764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22272336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	9374134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27527274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	12428211, 21971085, 24614960, 28923975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25617865, 30061623		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	12185132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	24400868, 28029690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrosis	Osteochondrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	30405713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28457943, 30189026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27153759, 30204862, 30287085, 31712560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17786474, 22855186, 23352643, 23644663, 28884359, 30992323, 31657439, 31810915, 6096004, 9874511		★★★★★ ★☆☆☆☆ Found in Text Mining only
OTOPALATODIGITAL SYNDROME, TYPE II	Oto-Palato-digital syndrome	BEFREE	19773341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	31737183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	16773570		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27383302, 27840988, 31558772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27383302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachygyria	Pachygyria	BEFREE	25052316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachygyria	Pachygyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12138232, 18584046, 21684285, 22110277, 22898637, 23121112, 24359721, 24728183, 25576918, 30092175, 30396925, 31358530, 8641471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30678127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29274400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	11448913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	11373270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	2347900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16908976, 17408955, 17939164, 24837686, 29429047, 29989488, 30945962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	16684786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21915271, 22790431, 25861618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	17981253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pena-Shokeir syndrome type I	Pena Shokeir syndrome	BEFREE	20621480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	24487800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	24487800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	23831330, 29306153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	BEFREE	23797724, 29318761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	25052316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28870634, 28928363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	29891411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	9578504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	15940367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	11104647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15068247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmented hairy epidermal nevus	Epidermal nevus	ORPHANET_DG	28347698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmented hairy epidermal nevus	Epidermal nevus	BEFREE	28625464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	16167532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	30567481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28821556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma	Poikiloderma	BEFREE	15068453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	15927810, 18528435, 18652585, 19120339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	26634693, 30459449		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	26634693, 30459449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16520345, 29074972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11148599, 22052386, 23205574, 27976512, 31234714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	25430793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porokeratosis, Disseminated Superficial Actinic	Porokeratosis	BEFREE	15928614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	20380724, 28768717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23326330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	16773570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16555084, 28789972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12791319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	26662404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	30808750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10440748, 11956481, 12187269, 15129425, 15948292, 16326072, 18095286, 18651557, 18694745, 20441232, 20454608, 21360565, 23575475, 25450398, 25883213 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28704809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29386530, 33107155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	28882457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27373931, 27402133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	28623647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	15695982, 23756437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20204736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21680953, 23434591, 25680454, 28446589, 29088003, 29703175, 29873400, 30099020, 30394340, 30448291, 30504086, 31125560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	1711202, 30760649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15596059, 19280651, 23158209, 23416984, 23521319, 26637866, 28498731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19741012, 23056222, 26940097, 28739140, 29049990, 29102563, 29150436, 29669350, 29925521, 30342194, 31682174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	29162704, 9767533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	28534511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	15589839, 30464047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12682090, 23950931, 7928191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31317786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	24671107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	24671107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	14662021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyoma	Rhabdomyoma	BEFREE	28091730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	2282206, 2323848, 3443230, 8160781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1711202, 17934089, 22634718, 28255205, 28647488, 29621504, 30208760, 30553912, 30760649, 30777378, 30920392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	BEFREE	28378834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	25768100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15163898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21412072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30459475, 35069780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20385374, 22675524, 23582872, 25113377, 25981171, 27927957, 29225346, 29380377, 31220216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	22675524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	22675524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	23289769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	15869600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	15823405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	9559653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	CTD_human_DG	16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory hearing loss	Hearing Loss	CTD_human_DG	16685646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16849637, 18492780, 27823961, 28154894, 28824642, 29320362, 29508629, 29775620, 30069314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15696101, 18836449, 19097825, 19482345, 28861919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	33178177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	19211642		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	26759119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	27895171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	28524745, 29113690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	2282206, 8160781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	29940288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida Occulta	Spina bifida occulta	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	32558393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	18629520, 20097679, 21920940, 24271012, 27699902, 28459188, 29016853, 29392327		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS 1	SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS	BEFREE	29928949		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 8	Spinocerebellar Ataxia	BEFREE	10888605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	12524342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	BEFREE	26883385, 29078305		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	27019229, 30796325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	20215423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16979613, 22767273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24460279, 25041015, 26190820, 28031525, 28504189, 28556501, 29620162, 29749321, 30327774, 31082616, 31409639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34486492	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	31593979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18324357, 27699902, 31159419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29358156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	11422610, 19449021, 21913943, 30260236, 30573200, 9075666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28534938, 29270876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507635, 25081706, 26745502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25232253	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31327802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcapsular cataract	Subcapsular cataract	BEFREE	22410565, 9449696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcortical cerebral atrophy	Subcortical cerebral atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	BEFREE	30518548		★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	29498567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17133606, 23874518, 25248297, 25917089, 26357964, 26360820, 8466280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28893863, 31594228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	11556493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular Diseases	BEFREE	30171969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	6189508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	26452979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	30315159, 35313204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	15001467, 28931895, 9713366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	28430966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31536596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23416984, 30136914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22223087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20446237, 30136914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	24900955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29024830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigonocephaly	Trigonocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22637570, 23792445, 27452906, 27859262, 30718260, 30867138, 31630284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32358373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	25277454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	28826686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndrome	Usher Syndrome	BEFREE	10704190		★★★★★ ★☆☆☆☆ Found in Text Mining only
USHER SYNDROME, TYPE IB (disorder)	Usher Syndrome	BEFREE	18700726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17021135, 28203428, 30168888, 31818892, 7775635, 9596271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31344830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveoretinal Coloboma	Uveoretinal Coloboma	CTD_human_DG	22366783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	12860454, 28220374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	11556493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24297048, 25857312, 28285002, 31115479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	19255346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral Myopathy	Visceral Myopathy	BEFREE	30430282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral Myopathy, Familial	Visceral Myopathy	BEFREE	22960657, 24777424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	15940367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	10573008		★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	24201301, 3258769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	23041135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	23112078		★★★★★ ★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	30256902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	14745832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	10397718, 10455421, 10666201, 11213796, 11950596, 12067437, 12177428, 12200375, 15385624, 17296785, 19307326, 19395286, 21178275, 21376381, 22674044 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked infantile spasms	Spasms X-Linked	BEFREE	30982501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Zebra body myopathy	Zebra Body Myopathy	BEFREE	17885449, 25747004		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with POTEF across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for POTEF.

Diseases Linked via Similar Genes Diseases curated for genes most similar to POTEF (see Related Genes above), that are NOT already directly curated for POTEF itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to POTEF.

POTEF (POTE ankyrin domain family member F)

Save This Analysis