Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10623
Gene name	RNA polymerase III subunit C
Gene symbol	POLR3C
Synonyms (NCBI Gene)	C82RPC3RPC62
Chromosome	1
Chromosome location	1q21.1

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	21358628
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	TAS	9171375
GO:0005515	Function	Protein binding	IPI	11416169, 20154270, 21358628, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	24107381, 33335104, 34675218
GO:0005666	Component	RNA polymerase III complex	IEA
GO:0005666	Component	RNA polymerase III complex	TAS	9171375
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006359	Process	Regulation of transcription by RNA polymerase III	TAS	9171375
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	19609254
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IMP	19609254
GO:0051607	Process	Defense response to virus	IEA

MIM	HGNC	e!Ensembl
617454	30076	ENSG00000186141

Q9BUI4

Protein name

DNA-directed RNA polymerase III subunit RPC3 (RNA polymerase III subunit C3) (DNA-directed RNA polymerase III subunit C) (RNA polymerase III 62 kDa subunit) (RPC62)

Protein function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (PubMed:20413673, PubMed:33558764, PubMed:33558766, PubMed:34675218, PubMed:35637192). Specific peripheric compone

PDB

2XUB , 2XV4 , 5AFQ , 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 8ITY , 8IUE , 8IUH , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05645	RNA_pol_Rpc82	146 → 345	RNA polymerase III subunit RPC82	Family
PF08221	HTH_9	7 → 68	RNA polymerase III subunit RPC82 helix-turn-helix domain	Domain

Sequence

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

Sequence length

534

Interactions

View interactions

KEGG Pathway	Reactome Pathway
RNA polymerase	Cytosolic sensors of pathogen-associated DNA
Cytosolic DNA-sensing pathway	RNA Polymerase III Transcription Initiation From Type 1 Promoter
	RNA Polymerase III Transcription Initiation From Type 2 Promoter
	RNA Polymerase III Transcription Initiation From Type 3 Promoter

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Decreased total lymphocyte count	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total neutrophil count	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484, 40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLR3C-related disorder	Uncertain significance; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
POLR3F	[]	6	["RNA polymerase","Cytosolic DNA-sensing pathway","RNA Polymerase III Transcription Initiation From Type 3 Promoter","Cytosolic sensors of pathogen-associated DNA ","RNA Polymerase III Transcription Initiation From Type 1 Promoter","RNA Polymerase III Transcription Initiation From Type 2 Promoter"]	[]
POLR3G	[]	6	["RNA polymerase","Cytosolic DNA-sensing pathway","RNA Polymerase III Transcription Initiation From Type 3 Promoter","Cytosolic sensors of pathogen-associated DNA ","RNA Polymerase III Transcription Initiation From Type 1 Promoter","RNA Polymerase III Transcription Initiation From Type 2 Promoter"]	[]
POLR3A	[]	6	["RNA polymerase","Cytosolic DNA-sensing pathway","RNA Polymerase III Transcription Initiation From Type 3 Promoter","Cytosolic sensors of pathogen-associated DNA ","RNA Polymerase III Transcription Initiation From Type 1 Promoter","RNA Polymerase III Transcription Initiation From Type 2 Promoter"]	[]
POLR3H	[]	6	["RNA polymerase","Cytosolic DNA-sensing pathway","RNA Polymerase III Transcription Initiation From Type 3 Promoter","Cytosolic sensors of pathogen-associated DNA ","RNA Polymerase III Transcription Initiation From Type 1 Promoter","RNA Polymerase III Transcription Initiation From Type 2 Promoter"]	[]
POLR3K	[]	6	["RNA polymerase","Cytosolic DNA-sensing pathway","RNA Polymerase III Transcription Initiation From Type 3 Promoter","Cytosolic sensors of pathogen-associated DNA ","RNA Polymerase III Transcription Initiation From Type 1 Promoter","RNA Polymerase III Transcription Initiation From Type 2 Promoter"]	[]

POLR3C (RNA polymerase III subunit C)

Save This Analysis