Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79070
Gene name	Protein O-glucosyltransferase 2
Gene symbol	POGLUT2
Synonyms (NCBI Gene)	EP58ERp58KDEL1KDELC1
Chromosome	13
Chromosome location	13q33.1
Summary	This gene encodes a protein product localized to the lumen of the endoplasmic reticulum. As a member of the endoplasmic reticulum protein family the encoded protein contains a Lys-Asp-Glu-Leu or KDEL motif located at the extreme C-terminus which prevents

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	ISS
GO:0005829	Component	Cytosol	IDA
GO:0006486	Process	Protein glycosylation	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0035251	Function	UDP-glucosyltransferase activity	IDA	30127001
GO:0035251	Function	UDP-glucosyltransferase activity	IEA
GO:0035252	Function	UDP-xylosyltransferase activity	IDA	30127001
GO:0035252	Function	UDP-xylosyltransferase activity	IEA
GO:0046527	Function	Glucosyltransferase activity	IBA
GO:0140561	Function	EGF-domain serine glucosyltransferase activity	IEA
GO:0140562	Function	EGF-domain serine xylosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
611613	19350	ENSG00000134901

Q6UW63

Protein name

Protein O-glucosyltransferase 2 (EC 2.4.1.-) (Endoplasmic reticulum resident protein 58) (ER protein 58) (ERp58) (KDEL motif-containing protein 1) (Protein O-xylosyltransferase POGLUT2) (EC 2.4.2.-)

Protein function

Protein glucosyltransferase that catalyzes the transfer of glucose from UDP-glucose to a serine residue within the consensus sequence peptide C-X-N-T-X-G-S-F-X-C (PubMed:30127001). Can also catalyze the transfer of xylose from UDP-xylose but les

PDB

2DI7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00630	Filamin	26 → 127	Filamin/ABP280 repeat	Domain
PF05686	Glyco_transf_90	148 → 500	Glycosyl transferase family 90	Family

Sequence

MFGTLLLYCFFLATVPALAETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGN
KFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQH
VAKSPYILKGPVYHENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIP
KRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDVELFVNLGDWP
LEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWES
KNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDENLYGPIVKHISFFDFF
KHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKKTKDEL

Sequence length

502

Interactions

View interactions

Related Genes Genes most often co-reported with POGLUT2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for POGLUT2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to POGLUT2 (see Related Genes above), that are NOT already directly curated for POGLUT2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to POGLUT2.

POGLUT2 (protein O-glucosyltransferase 2)

Save This Analysis