PODN (podocan)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 127435
• Gene name: Podocan
• Gene symbol: PODN
• Synonyms (NCBI Gene): PCAN, SLRR5A
• Chromosome: 1
• Chromosome location: 1p32.3
• Summary: The protein encoded by this gene is a member of the small leucine-rich repeat protein family and contains an amino terminal CX3CXCX7C cysteine-rich cluster followed by a leucine-rich repeat domain. Studies suggest that this protein could function to inhib

miRNA Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017543	hsa-miR-335-5p	Microarray	18185580
MIRT1246368	hsa-miR-124	CLIP-seq
MIRT1246369	hsa-miR-4484	CLIP-seq
MIRT1246370	hsa-miR-506	CLIP-seq
MIRT1246371	hsa-miR-548an	CLIP-seq
MIRT1246372	hsa-miR-1265	CLIP-seq
MIRT1246373	hsa-miR-1292	CLIP-seq
MIRT1246374	hsa-miR-184	CLIP-seq
MIRT1246375	hsa-miR-1909	CLIP-seq
MIRT1246376	hsa-miR-214	CLIP-seq
MIRT1246377	hsa-miR-2392	CLIP-seq
MIRT1246378	hsa-miR-3153	CLIP-seq
MIRT1246379	hsa-miR-323-5p	CLIP-seq
MIRT1246380	hsa-miR-3619-5p	CLIP-seq
MIRT1246381	hsa-miR-4291	CLIP-seq
MIRT1246382	hsa-miR-4318	CLIP-seq
MIRT1246383	hsa-miR-4443	CLIP-seq
MIRT1246384	hsa-miR-4506	CLIP-seq
MIRT1246385	hsa-miR-4668-5p	CLIP-seq
MIRT1246386	hsa-miR-4685-5p	CLIP-seq
MIRT1246387	hsa-miR-4716-3p	CLIP-seq
MIRT1246388	hsa-miR-4723-5p	CLIP-seq
MIRT1246389	hsa-miR-4728-5p	CLIP-seq
MIRT1246390	hsa-miR-761	CLIP-seq
MIRT1246391	hsa-miR-876-3p	CLIP-seq
MIRT1246392	hsa-miR-922	CLIP-seq
MIRT1246386	hsa-miR-4685-5p	CLIP-seq
MIRT1552431	hsa-miR-4722-3p	CLIP-seq
MIRT1552432	hsa-miR-4755-3p	CLIP-seq
MIRT2072757	hsa-miR-134	CLIP-seq
MIRT2072758	hsa-miR-3118	CLIP-seq
MIRT2072759	hsa-miR-4524	CLIP-seq
MIRT2072760	hsa-miR-759	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005518	Function	Collagen binding	IDA	15063725
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15063725
GO:0005737	Component	Cytoplasm	IDA	15063725
GO:0005737	Component	Cytoplasm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15063725
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	27068509
GO:0030336	Process	Negative regulation of cell migration	IDA	15063725
GO:0031012	Component	Extracellular matrix	HDA	27068509

Other IDs

• MIM: 608661
• HGNC: 23174
• e!Ensembl: ENSG00000174348

Protein

• UniProt ID: Q7Z5L7
• Protein name: Podocan
• Protein function: Negatively regulates cell proliferation and cell migration.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13306	LRR_5	109 → 234	BspA type Leucine rich repeat region (6 copies)	Repeat
  PF13855	LRR_8	238 → 300	Leucine rich repeat	Repeat
  PF13855	LRR_8	380 → 442	Leucine rich repeat	Repeat
  PF13855	LRR_8	451 → 513	Leucine rich repeat	Repeat
  PF13855	LRR_8	522 → 583	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Kidney, heart, liver, pancreas and vascular smooth muscle cells. Also detected in aortic intima (at protein level). {ECO:0000269|PubMed:12796502, ECO:0000269|PubMed:15063725, ECO:0000269|PubMed:20551380}.
• Sequence:

  MAQSRVLLLLLLLPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPG
  PGPAAVSCPRDCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLH
  RLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLT
  KIYGLTFGQKPNLRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPAL
  YKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNL
  SRVPAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKR
  LHTVHLYNNALERVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQ
  VHRDAFRKLRLLRSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALVGMAQLREL
  YLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPAN
  AFDSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLGKEKE
  EEEEEEEEEEETR

• Sequence length: 613

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	24043300		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24043300		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35257412	Associate	★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24043300		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27037601		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32174791	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for PODN.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PODN.