PNMA8C (PNMA family member 8C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 110806277
Gene name PNMA family member 8C
Gene symbol PNMA8C
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.32
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620934 53427 ENSG00000277531
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GUJ8
Protein name Paraneoplastic antigen-like protein 8C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14893 PNMA 7 → 158 PNMA Family
Sequence 
MLFGVKDIALLEHGCKALEVDSYKSLMILGIPEDCNHEEFEEIIRLPLKPLGKFEVAGKA
YLEEDKSKAAIIQLTEDINYAVVPREIKGKGGVWRVVYMPRKQDIEFLTKLNLFLQSEGR
TVEDMARVLRQELCPPATGPRELPARKCSVPGLGEKPEAGATVQMDVVPPLDSSEKESKA
GVGKRGKRKNKKNRRRHHASDKKL
Sequence length 204
Interactions View interactions

No strongly related genes found yet for PNMA8C.

No additional diseases found yet through genes similar to PNMA8C.