PMS2P5 (PMS1 homolog 2, mismatch repair system component pseudogene 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 5383
Gene name PMS1 homolog 2, mismatch repair system component pseudogene 5
Gene symbol PMS2P5
Synonyms (NCBI Gene)
PMS2L5PMS7
Chromosome 7
Chromosome location 7q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0006298 Process Mismatch repair IEA
GO:0016887 Function ATP hydrolysis activity IEA
GO:0032300 Component Mismatch repair complex IEA
GO:0140664 Function ATP-dependent DNA damage sensor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MQ11
Protein name Postmeiotic segregation increased 2-like protein 5 (Postmeiotic segregation increased protein 4) (Postmeiotic segregation increased protein 7) (Putative postmeiotic segregation increased 2 pseudogene 5)
Family and domains
Sequence 
MWGRRRKLRRLNDVTISTCHVSAKVGTRLVFDHDGKIIQKTPYPHPRGTTVSVKQLFSTL
PVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTPRSTPPHPCSLEDNVI
TVFSSVKNGPGSSR
Sequence length 134
Interactions View interactions

No strongly related genes found yet for PMS2P5.

No additional diseases found yet through genes similar to PMS2P5.